DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ec and Tsp42Eg

DIOPT Version :9

Sequence 1:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster


Alignment Length:238 Identity:48/238 - (20%)
Similarity:100/238 - (42%) Gaps:43/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCLSGIVNFILYIVNIVFLIVGILLIVLGSIMLSDLSRFDVAGSGTDPNTIPICVTVLGGLIFV 65
            |.|.:.::.......:|:..:.|:::|.||..::.....|         ||....:..:|.::.:
  Fly     1 MACSTNVLKGFALFWDIILALFGLVVIGLGVHIIYKFEHF---------NTAAFVIIAVGVVVVL 56

  Fly    66 VSFFGCYGIFRQSVCMTGAYTSMVFVLFILQLVLTCWVFVNRSAFLGDMSNLVNLLWDSH----- 125
            .:.||..|..|:|...:..:..::.||.||:::...:::|.:::.|.::....:.||:..     
  Fly    57 TALFGALGAARESSATSKVFVVILIVLVILEVLAVGFLWVFQTSLLINVDKTFDKLWNDQPVPIK 121

  Fly   126 --DYTAMGVLEETFGCCGDTSYTNYNNIGLSVPGTCCGYLDRQATCNTPSVYQSRPGCSAKFEEF 188
              :.:.:..||....|||:...::|    :..|.:|         .|..|...:..||..||.:|
  Fly   122 PGNQSQIASLERWLDCCGNVGPSDY----ILPPNSC---------YNGESDKLNLEGCRQKFLDF 173

  Fly   189 WNDNMDIIRWSGLGL---------CIFDLVVFLIAGALTNCMR 222
            ..|     ||:...|         .|..|:.:::|.::.|..|
  Fly   174 IAD-----RWTTFNLVSLVLLGVELICALLAYVLANSIVNRWR 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 45/229 (20%)
tetraspanin_LEL 104..193 CDD:239401 20/95 (21%)
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 43/211 (20%)
tetraspanin_LEL 95..176 CDD:239401 19/93 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443005
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.