DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ec and Tsp29Fa

DIOPT Version :9

Sequence 1:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster


Alignment Length:250 Identity:63/250 - (25%)
Similarity:115/250 - (46%) Gaps:59/250 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCLSGIVNFILYIV---NIVFLIVGILLIVLGSIMLSDLSRFDVAGSGTDPN-----------T 51
            |..|:|..|.:.|.:   |::|||.||:||.:|            ||.|....           :
  Fly     1 MSLLTGSANAVKYTLFGFNLIFLITGIILIAVG------------AGVGAVYTGYKLFLAGKFFS 53

  Fly    52 IPICVTVLGGLIFVVSFFGCYGIFRQSVCMTGAYTSMVFVLFILQLVLTCWVFVNRSAFLGDMSN 116
            ||..:.|:|..|.::|||||:|..:::.|:..:::.|:.::|||:|......:|.|:    |.|:
  Fly    54 IPTFLIVIGSFIIIISFFGCWGALKENYCLVLSFSVMLAIIFILELAAGISGYVLRN----DASD 114

  Fly   117 LV--NLLWDSHDYTAMGV---------LEETFGCCGDTSYTNY-----NNIGLSVPGTCC----G 161
            |:  :|.:..::|.::..         :::.|.|||.|||.::     |.   .:|.:||    |
  Fly   115 LIKTSLTYSLNEYNSINPNATTKLWDDIQDEFECCGVTSYNDWITAFPNG---DLPISCCNVHVG 176

  Fly   162 YLDRQATCNTPS---VYQSRPGCSAKFEEFWNDNMDIIRWSGLGLCIFDL--VVF 211
            .:. ..|||...   ..:.:.||...|..:.:.:...:..:|:.:.|...  |:|
  Fly   177 AVG-TFTCNNAQSSVADRHKVGCLDGFSGYISAHAVSLGAAGVVIAILQFFGVIF 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 59/243 (24%)
tetraspanin_LEL 104..193 CDD:239401 25/111 (23%)
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 58/239 (24%)
tetraspanin_LEL 106..210 CDD:239401 25/111 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443006
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.