DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ec and Tsp5D

DIOPT Version :9

Sequence 1:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster


Alignment Length:275 Identity:66/275 - (24%)
Similarity:108/275 - (39%) Gaps:76/275 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VNFILYIVNIVFLIVGILLIVLGSIMLSDLSRFDVAG--------SGTDPNTIPICVTVLGGLIF 64
            :|.||::.:..||..|:.|            |...||        :|...:||   ...:||..|
  Fly    16 LNIILWLCSCAFLGAGLWL------------RLSYAGYATLLPQHAGLSADTI---FMGIGGTGF 65

  Fly    65 VVSFFGCYGIFRQSVCMTGAYTSMVFVLFILQLVLTCWVFVNRSAFLGDMSN------------- 116
            |||||||.|.:.||.|:...|..::.:||:.:.::....|:.|......::|             
  Fly    66 VVSFFGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSS 130

  Fly   117 --------LVNLLWDSHDYTAMGVLEETFGCCGDTSYTNYNNI----GLS-VPGTCCG--YLDRQ 166
                    .|..:|||        ::::|.|||.:||.::.:|    |.. ||.:||.  |..||
  Fly   131 DRGSLVAPSVASIWDS--------VQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQ 187

  Fly   167 A------------TC---NTPSVYQSRPGCSAKFEEFWNDNMDIIRWSGLGLCIFDLVVFLIAGA 216
            .            .|   ..||::..: ||:...:.::...::::...|||:....| ..||...
  Fly   188 VLTEGSGDGMMRPDCGRSENPSLWWDK-GCAHSLQSWFTGQLNVVGAVGLGIAFVQL-FGLITSM 250

  Fly   217 LTNCMRSQNAGRQVY 231
            |..|..........|
  Fly   251 LLFCTVKHKRASDTY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 64/263 (24%)
tetraspanin_LEL 104..193 CDD:239401 27/131 (21%)
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 65/264 (25%)
NET-5_like_LEL 105..228 CDD:239418 27/131 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.