DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ec and Cd9

DIOPT Version :9

Sequence 1:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_444177.1 Gene:Cd9 / 24936 RGDID:2318 Length:226 Species:Rattus norvegicus


Alignment Length:225 Identity:42/225 - (18%)
Similarity:88/225 - (39%) Gaps:33/225 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SGIVNFILYIVNIVFLIVGILLIVLGSIMLSDLSRFDVAGSGTDPNTIPICVTVL---GGLIFVV 66
            |..:.::|:..|.:|.:.||.::.:|..:..|.....:....|:.::....|.:|   |.|:.:|
  Rat     7 SKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNHSSFYTGVYILIGAGALMMLV 71

  Fly    67 SFFGCYGIFRQSVCMTGAYTSMVFVLFILQLVLTCWVFVNRSAFLGDMSNLVNLLW------DSH 125
            .|.||.|..::|.||.|.:...:.|:|.:::....|.:.::...:.::.......:      |..
  Rat    72 GFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRNKDEP 136

  Fly   126 DYTAMGVLEETFGCCGDTSYTNYNNIGLSVPGTCCGYLDR--QATCNTPSVYQS--RPGCSAKFE 186
            ....:..:.....|||                 ..|.:::  ...|....|.:|  ...|....:
  Rat   137 QRETLKAIHMALNCCG-----------------IAGGVEQFISDICPKKQVLESFQVKSCPDAID 184

  Fly   187 EFWNDNMDIIRWSGLGLC---IFDLVVFLI 213
            |.::....||...|:|:.   ||.::..:|
  Rat   185 EVFHSKFHIIGAVGIGIAVVMIFGMIFSMI 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 41/223 (18%)
tetraspanin_LEL 104..193 CDD:239401 10/98 (10%)
Cd9NP_444177.1 Tetraspannin 10..215 CDD:395265 41/222 (18%)
CD9_LEL 109..191 CDD:239405 10/98 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.