DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ec and CG30160

DIOPT Version :9

Sequence 1:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_724526.1 Gene:CG30160 / 246490 FlyBaseID:FBgn0050160 Length:222 Species:Drosophila melanogaster


Alignment Length:227 Identity:95/227 - (41%)
Similarity:135/227 - (59%) Gaps:8/227 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCLSGIVNFILYIVNIVFLIVGILLIVLGSIMLSDLSRFDVAGSGTDPNTIPICVTVLGGLIFV 65
            |.|||.:..::||::|:||:..||||||:||||||.:..|.....|.:..|||||:.|:|.:.||
  Fly     1 MNCLSAMFKYLLYLLNLVFVAGGILLIVVGSIMLSTMGNFTAFDGGVNTQTIPICIIVIGSVTFV 65

  Fly    66 VSFFGCYGIFRQSVCMTGAYTSMVFVLFILQLVLTCWVFVNRSAFLGDMSNLVNLLWDSHDYT-- 128
            |:||||.|..|::.|.|..|...:.:||.|||.|:.|:|.....||..|...|:..||.::..  
  Fly    66 VAFFGCCGTIRENACCTTIYAICMLILFGLQLALSIWIFAANDKFLSSMGKAVDKAWDENNAAQG 130

  Fly   129 -AMGVLEETFGCCGDTSYTNYNNIGLSVPGTCCGYLDRQATCNTPSVYQSRPGCSAKFEEFWNDN 192
             .|..|:..|.|||:|.|..|.    :||.:||||.||...|.. .:|..||||..:|.:||..|
  Fly   131 YPMDALQLAFSCCGNTGYQQYE----TVPSSCCGYKDRTKVCEA-EIYSQRPGCRQEFVDFWASN 190

  Fly   193 MDIIRWSGLGLCIFDLVVFLIAGALTNCMRSQ 224
            .|:||||.|.:.:|:|.:|:::..|.:.||.:
  Fly   191 TDLIRWSSLIIALFELGIFIMSCCLASAMRKR 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 89/216 (41%)
tetraspanin_LEL 104..193 CDD:239401 33/91 (36%)
CG30160NP_724526.1 Tetraspannin 8..219 CDD:278750 89/215 (41%)
tetraspanin_LEL 104..191 CDD:239401 33/91 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467671
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.