DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ec and TSPAN19

DIOPT Version :9

Sequence 1:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001094387.1 Gene:TSPAN19 / 144448 HGNCID:31886 Length:248 Species:Homo sapiens


Alignment Length:242 Identity:61/242 - (25%)
Similarity:99/242 - (40%) Gaps:43/242 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVNFILYIVNIVFLIVGILLIVLGSIMLSDLSRFDVAGSGTDPNTIPICVTVLGGLIFVVSF--F 69
            |:.:.|.::|..||::|:|.:..|:.:|.|.:.|..|....:...:||...::|.....|.|  .
Human     9 IIKYFLNLINGAFLVLGLLFMGFGAWLLLDRNNFLTAFDENNHFIVPISQILIGMGSSTVLFCLL 73

  Fly    70 GCYGIFRQSVCMTGAYTSMVFVLFILQLVLTCWVFVNRSAFLGDMSNLVNLLWDSHD-------- 126
            |..||..:...:...|..::...|.:|:||        |||:......|..||  ||        
Human    74 GYIGIHNEIRWLLIVYAVLITWTFAVQVVL--------SAFIITKKEEVQQLW--HDKIDFVISE 128

  Fly   127 ------------YTAMGVLEETFGCCGDTSYT------NYNNIGLSVPGTCCGYLDRQATCNTPS 173
                        :|.:..|::|..|||..:||      |..|.| .||.:|.....|:..|:.|.
Human   129 YGSKDKPEDITKWTILNALQKTLQCCGQHNYTDWIKNKNKENSG-QVPCSCTKSTLRKWFCDEPL 192

  Fly   174 VYQSRPGCSAKFEEFWNDNMDIIRWSGLGLCIFDLVVFLIAGALTNC 220
            ......||..|...::|.|  ::...|:...:....||.:  :||.|
Human   193 NATYLEGCENKISAWYNVN--VLTLIGINFGLLTSEVFQV--SLTVC 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 61/242 (25%)
tetraspanin_LEL 104..193 CDD:239401 29/114 (25%)
TSPAN19NP_001094387.1 Tetraspannin 9..240 CDD:278750 61/242 (25%)
CD37_CD82_like_LEL 107..212 CDD:239413 27/109 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47789
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.