DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ec and tsp-6

DIOPT Version :9

Sequence 1:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001294830.1 Gene:tsp-6 / 13219712 WormBaseID:WBGene00006632 Length:237 Species:Caenorhabditis elegans


Alignment Length:255 Identity:54/255 - (21%)
Similarity:106/255 - (41%) Gaps:54/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GCLSGIVNFILYIVNIVFLIVGILLIVLGSIMLSDLSRFDVAGSGT--------------DPNTI 52
            ||.:..|.:..:::|.:|.::|.:::.|...||.|.:..:...|..              ..|:.
 Worm     4 GCGNKCVKYFFWLINFLFFVLGAIIVGLSIWMLVDKNSLNTVASTVKVDLSQILSQVNIQQLNSF 68

  Fly    53 PICVTVLGGLIFVVSFFGCYGIFRQSVCMTGAYTSMVFVLFILQLVLTCWVFVNRSAFLGDMSNL 117
            .....|:||.:.|:.||||.|...:|:|....|..:|.:||::::|.....|||::    ::...
 Worm    69 LYVAIVIGGALLVLGFFGCCGSCCESICAISIYFILVLILFVVEVVAIVLYFVNKT----NLQQG 129

  Fly   118 VNLLW----------DSHDYTAMGVLEETFGCCGDTSYTNYNNIGLSVPGTC-CGYLDRQATCNT 171
            ...:|          ....:..:..::.:..|||.:..::|...| :.|.:| |..: :||.|.|
 Worm   130 FQTIWRDELVSKYNTQQQIHQVLDQIQSSLQCCGASGCSDYIPYG-AFPTSCQCATI-QQAGCAT 192

  Fly   172 PSVYQSRPGCSAKFEEFWN---DNMDIIRWSGLGLCIFDLVVF----LIAGALTNCMRSQ 224
                           ..||   .::..:.:.|:.:...:|:..    :|.||:.. .|||
 Worm   193 ---------------VIWNSFESSLIYVAFVGIIILFVELLAMIFSCIIIGAVKE-KRSQ 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 49/245 (20%)
tetraspanin_LEL 104..193 CDD:239401 18/102 (18%)
tsp-6NP_001294830.1 Tetraspannin 9..227 CDD:278750 46/238 (19%)
tetraspanin_LEL 120..202 CDD:239401 18/102 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.