DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ec and Tsp68C

DIOPT Version :9

Sequence 1:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster


Alignment Length:274 Identity:67/274 - (24%)
Similarity:109/274 - (39%) Gaps:65/274 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FILYIVNIVFLIVGILLIVLGSIMLSD-----LSRFDVAGSGTDPNTIP--------ICVTVLGG 61
            |:|.:.|.:|||.|:||:|.|..:.||     |||. :|.|....:::|        :.|.:.|.
  Fly     9 FVLNLCNFLFLICGLLLVVSGLYIFSDNKRILLSRL-LAASSDRLSSLPQPLLFYIALGVAIAGF 72

  Fly    62 LIFVVSFFGCYGIFRQSVCMTGAYTSMVFVLF----ILQLVLTCWVFVNRSAFLG---DMSNLVN 119
            :..:.:..|.:.....:.|....|...|.||.    :|.|.:|.|...     ||   |.:.:|.
  Fly    73 VATLAAVVGFWASCLHTYCFLTIYFLSVVVLLLTESVLCLAITLWPHC-----LGISLDETQMVR 132

  Fly   120 LLWDSH------DYT-AMGVLEETFGCCG-------DTS---YTNYNNIGLSVPGTCC------- 160
            .|..::      .:| |:.:.:..|||||       |||   ...|......||.:||       
  Fly   133 SLQSNYGVPGQEQFTNALDLAQVRFGCCGMRSSLDYDTSLWRLQGYGQRNWPVPLSCCFLKNAGH 197

  Fly   161 --GYLD----RQATCNT---PSVYQSR--PGCSAKFEEFWNDNMDIIRWSGLGLCIFDLVVFLIA 214
              .|||    .::.|.:   .|..:.|  ..|....:.::.:...|...:.|.|.:.:..|.|  
  Fly   198 SMAYLDPKPANESMCQSLERLSYERERHTESCLPHLDNWYREQYSIFLGASLILAMIEFCVLL-- 260

  Fly   215 GALTNC--MRSQNA 226
            ..:.:|  :.||.|
  Fly   261 AIIMSCTGLASQRA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 64/267 (24%)
tetraspanin_LEL 104..193 CDD:239401 27/126 (21%)
Tsp68CNP_729926.1 Tetraspannin 8..267 CDD:278750 63/265 (24%)
tetraspanin_LEL 117..241 CDD:239401 28/128 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.