DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ec and XB5740125

DIOPT Version :9

Sequence 1:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_002934840.1 Gene:XB5740125 / 100145428 XenbaseID:XB-GENE-5740126 Length:245 Species:Xenopus tropicalis


Alignment Length:193 Identity:46/193 - (23%)
Similarity:85/193 - (44%) Gaps:32/193 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IPICVTVLGGLIFVVS-FFGCYGIFRQSVCMTGAYTSMVFVLFILQL----VLTCWVFVNRSAFL 111
            ||..:.|.|....|:: ..||....:.|.|..|.:  |.||:.:|.|    .:..:::::|..| 
 Frog    52 IPSGMAVTGTFFLVINGLLGCCISKKGSRCQQGCF--MYFVVIVLCLEASAAVLAFLYMDRMDF- 113

  Fly   112 GDMSNLVNLLWDSHDYTAMGV----LEETFGCCGDTSYTNYN-----NIGLSVPGTCCGYLDRQA 167
             ::..::. .::::|.:...|    :::...|||..:||::.     ....::|.|||.  :...
 Frog   114 -ELKPMLE-AFENYDGSKSDVTVNKIQKELRCCGLHNYTDWEATSWYRQNFTIPKTCCN--ETYT 174

  Fly   168 TC--NT---PSVYQSRPGCSAKFEEFWNDNMDIIRWSGLGLCIFDLVVFLIAGALTNCMRSQN 225
            ||  ||   .:.||.  ||..|.....|..|..:.||    ||..|:..::|......:.::|
 Frog   175 TCYGNTTESKAFYQE--GCFDKLHHRLNYFMTWLFWS----CIAVLIAQVLAAIGDGLLMTRN 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 45/187 (24%)
tetraspanin_LEL 104..193 CDD:239401 23/102 (23%)
XB5740125XP_002934840.1 Tetraspannin 9..222 CDD:366035 45/182 (25%)
tetraspanin_LEL 104..204 CDD:351888 23/106 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.