DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30159 and C3orf33

DIOPT Version :9

Sequence 1:NP_001163069.1 Gene:CG30159 / 35611 FlyBaseID:FBgn0050159 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001295158.1 Gene:C3orf33 / 285315 HGNCID:26434 Length:294 Species:Homo sapiens


Alignment Length:253 Identity:62/253 - (24%)
Similarity:100/253 - (39%) Gaps:74/253 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LAIYGTSAIMLAVAYAKRKPAYLVRQFKQPSHIPERLINERVMHTGKIAGVKQQEQDTLLMIQHR 92
            :||.|...::.::.        |..:|...|.||...|...|...|::..:.:..    |.|:|.
Human    44 MAIAGIMLLLRSIR--------LTSKFTSSSDIPVEFIRRNVKLRGRLRRITENG----LEIEHI 96

  Fly    93 PL-FPIFTSSKR----LLPVKLPGVRVNANGYSWLQQ----------CLIGRE--ATFLPLKSAK 140
            |: .||..|.::    .|.|||.||.:...|.:|||:          .|:|:|  |.|..|..:|
Human    97 PITLPIIASLRKEPRGALLVKLAGVELAETGKAWLQKELKPSQLLWFQLLGKENSALFCYLLVSK 161

  Fly   141 GQDFVVCQLCLVHPPRGNRLLDVSETLLKLRFARFVQDAAAAVKKNGKYY----QHLKKVEQTT- 200
            |..|.|               :::|.:|:....:.|  ....:|.:.|.|    ::|.|.|.|. 
Human   162 GGYFSV---------------NLNEEILRRGLGKTV--LVKGLKYDSKIYWTVHRNLLKAELTAL 209

  Fly   201 ----------AEKEAWL-----SWAAGYPYIWRRYNELRQRW----LPKEKLLPELVR 239
                      :|||::|     ||..    ||::.:.|:...    |.||....:|.|
Human   210 KKGEGIWKEDSEKESYLEKFKDSWRE----IWKKDSFLKTTGSDFSLKKESYYEKLKR 263



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CA9R
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1030642at2759
OrthoFinder 1 1.000 - - FOG0006548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109413
Panther 1 1.100 - - LDO PTHR28434
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.