DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17002 and Gps2

DIOPT Version :9

Sequence 1:NP_610253.1 Gene:CG17002 / 35610 FlyBaseID:FBgn0033122 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_006246845.1 Gene:Gps2 / 497941 RGDID:1562746 Length:400 Species:Rattus norvegicus


Alignment Length:392 Identity:102/392 - (26%)
Similarity:161/392 - (41%) Gaps:106/392 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SNAAAQAAKAERAEKLRGALKGFIVADRQR-RQEE------FEAQCEEQRLRREREEVERQNQVA 67
            |||.|:            ||...|:.:|:| ||||      .|.:.:|::.||:::|:|  .:::
  Rat    11 SNAMAR------------ALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEME--ERMS 61

  Fly    68 LDDTRGQITRLDEQLADLHSQKHQLTVQLKKVLNEDETRKKLAKENELFAIQQAAASSPVFLPPL 132
            |::|:.||.:|.::|:.|..:||||.:||||||:|:|.|:: .::::|..:..||....:.:   
  Rat    62 LEETKEQILKLQQKLSALQEEKHQLFLQLKKVLHEEEKRRR-KEQSDLTTLTSAAYQQSLTV--- 122

  Fly   133 RLQHQHHTLMQKLPSGGQPGKRGRSPSPPSQQQA-------------YYKSAASYA-QQKHDDYR 183
                  ||....|...|.||...|..:..:..:|             |..|||::| ..:|    
  Rat   123 ------HTGTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEH---- 177

  Fly   184 RAADYARLSWNKTAAQYPGTGTVFYQTVAPPPTTQHQADARLQSIYNYNLPLRQAYHVDLPSATV 248
                          .|:.|:....|.|..|||              :|. |.:.||.   ||..:
  Rat   178 --------------GQFQGSPGGAYGTAQPPP--------------HYG-PTQPAYS---PSQQL 210

  Fly   249 SKPPDSQSPKAPSQSQPMQVLHINLDQPTISQADLVAQAGGSLSVKASQPHVTME-KLPDRYHIE 312
            ..|....:.:..||.||.........|||  |...: |.|.:||::....|...: ...|...:.
  Rat   211 RAPSAFPAVQYLSQPQPQPYAVHGHFQPT--QTGFL-QPGSALSLQKQMEHANQQTSFSDSSSLR 272

  Fly   313 VKHDGQPPSHVPPPPHLL--PE--------GVIFKPLLNEL--SLHSNVLQ-----ISSSQFPPQ 360
            ..|    |..:.|.|.||  |:        |....|..|..  ||.||..:     .|:.|..|.
  Rat   273 PMH----PQALHPAPGLLASPQLPVQIQAAGKALPPPANRALDSLSSNTARTHDSITSNHQITPT 333

  Fly   361 NP 362
            :|
  Rat   334 HP 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17002NP_610253.1 G_path_suppress 23..271 CDD:292610 70/268 (26%)
Gps2XP_006246845.1 G_path_suppress 5..292 CDD:406402 91/347 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335678
Domainoid 1 1.000 71 1.000 Domainoid score I9281
eggNOG 1 0.900 - - E1_298IM
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5176
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto98704
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22654
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.850

Return to query results.
Submit another query.