DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17002 and GPS2

DIOPT Version :9

Sequence 1:NP_610253.1 Gene:CG17002 / 35610 FlyBaseID:FBgn0033122 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_004480.1 Gene:GPS2 / 2874 HGNCID:4550 Length:327 Species:Homo sapiens


Alignment Length:424 Identity:103/424 - (24%)
Similarity:161/424 - (37%) Gaps:146/424 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SNAAAQAAKAERAEKLRGALKGFIVADRQR-RQEE------FEAQCEEQRLRREREEVERQNQVA 67
            |||.|:            ||...|:.:|:| ||||      .|.:.:|::.||:::|:|  .:::
Human    11 SNAMAR------------ALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEME--ERMS 61

  Fly    68 LDDTRGQITRLDEQLADLHSQKHQLTVQLKKVLNEDETRKKLAKENELFAIQQAAASSPVFLPPL 132
            |::|:.||.:|:|:|..|..:||||.:||||||:|:|.|:: .::::|..:..||....:.:   
Human    62 LEETKEQILKLEEKLLALQEEKHQLFLQLKKVLHEEEKRRR-KEQSDLTTLTSAAYQQSLTV--- 122

  Fly   133 RLQHQHHTLMQKLPSGGQPGKRGRSPSPPSQQQA-------------YYKSAASYA-QQKHDDYR 183
                  ||....|...|.||...|..:..:..:|             |..|||::| ..:|    
Human   123 ------HTGTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEH---- 177

  Fly   184 RAADYARLSWNKTAAQYPGTGTVFYQTVAPPPTTQHQADARLQSIYNYNLPLRQAYHVDLPSATV 248
                          .|:.|:....|.|..|||              :|. |.:.||.   ||..:
Human   178 --------------GQFQGSPGGAYGTAQPPP--------------HYG-PTQPAYS---PSQQL 210

  Fly   249 SKPPDSQSPKAPSQSQPMQVLHINLDQPTISQADLVAQAGGSLSVKASQPHVTMEK-LPDRYHIE 312
            ..|....:.:..||.||.........|||  |...: |.||:||::....|...:. ..|...:.
Human   211 RAPSAFPAVQYLSQPQPQPYAVHGHFQPT--QTGFL-QPGGALSLQKQMEHANQQTGFSDSSSLR 272

  Fly   313 VKHDGQPPSHVPPPPHLLPEGVIFKPLLNELSLHSNVLQISSSQFPPQNPKTAGSITQGYAPGRG 377
            ..|    |..:.|.|.||                      :|.|.|.|.                
Human   273 PMH----PQALHPAPGLL----------------------ASPQLPVQM---------------- 295

  Fly   378 GSAHEQQLARQQLAMLPGQPGAPSG-SGSAQPPP 410
                              ||...|| :.::||.|
Human   296 ------------------QPAGKSGFAATSQPGP 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17002NP_610253.1 G_path_suppress 23..271 CDD:292610 71/268 (26%)
GPS2NP_004480.1 G_path_suppress 5..292 CDD:406402 94/369 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..65 13/40 (33%)
interaction with SUMO. /evidence=ECO:0000269|PubMed:20159957 61..94 16/32 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..208 13/66 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..327 19/119 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141963
Domainoid 1 1.000 72 1.000 Domainoid score I9372
eggNOG 1 0.900 - - E1_298IM
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22654
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5091
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.