DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vimar and si:dkey-21e13.3

DIOPT Version :9

Sequence 1:NP_995767.1 Gene:vimar / 35609 FlyBaseID:FBgn0022960 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001314946.1 Gene:si:dkey-21e13.3 / 100150043 ZFINID:ZDB-GENE-130531-75 Length:291 Species:Danio rerio


Alignment Length:280 Identity:67/280 - (23%)
Similarity:104/280 - (37%) Gaps:70/280 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 PKPNKNAVIQAGLVQTILPMLEIHQPPVVFKLLGTLRMTVDGQEKLALELLKNKTLIEQLVHWSK 456
            ||.:.:|.|:|..|.|.|...|             |:..:|....:|:|  :...:.||:|    
Zfish    14 PKDSLSAAIEAISVSTELVEDE-------------LKPYLDAVLNVAIE--RKNGISEQVV---- 59

  Fly   457 SSDYAGVTGESLRLMAWLIKHAYLSKIAYALPRKGDAPA-EQIAD--------KIPLTQD----- 507
            .|....|..:.||..:.|..|.  :::...|.|  |||. :|..|        .:.|:||     
Zfish    60 ESGILPVLAQILRRKSTLTTHT--ARLVAELAR--DAPVRDQCFDTGIVSALVTLLLSQDQDLLL 120

  Fly   508 ----------YDRSSLSEFLANEGTVEAMVSMLTAQHLVMQNEALIALCILSVVYLSQPSEAAQA 562
                      ||.:...|.....|.|..:||:| .||  ..||||.:.|:|::..|:...|...:
Zfish   121 HVSQAIARICYDSNLQQERFLRLGAVPRLVSVL-LQH--SNNEALRSSCLLALCNLADMGEEDGS 182

  Fly   563 QLLQDELVKCEVGKKLAELISKSSDTMTKEI----------------VENLQNCVNLLKSSEQLV 611
            .|..:|......|:.:....|:.|...:..:                ||.||.|..:|..:..  
Zfish   183 MLSWEEGAHFGEGEHVFRGTSRYSFGFSSAVTVVRLKQWTNGQYSVAVEVLQRCSTMLWGANN-- 245

  Fly   612 AHLEQHNINEL--LKSIPIL 629
            .|...|.::..  |.|.|.|
Zfish   246 GHQNGHRLSNFSNLSSCPKL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vimarNP_995767.1 ARM 55..155 CDD:237987
armadillo repeat 77..118 CDD:293788
armadillo repeat 124..165 CDD:293788
armadillo repeat 318..343 CDD:293788
ARM 322..428 CDD:237987 9/35 (26%)
armadillo repeat 351..391 CDD:293788
armadillo repeat 396..428 CDD:293788 7/31 (23%)
si:dkey-21e13.3NP_001314946.1 ARM 56..174 CDD:237987 35/128 (27%)
armadillo repeat 57..88 CDD:293788 8/36 (22%)
armadillo repeat 95..131 CDD:293788 5/35 (14%)
armadillo repeat 137..173 CDD:293788 14/38 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004617
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.