DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6u1 and CYP97A3

DIOPT Version :9

Sequence 1:NP_001286149.1 Gene:Cyp6u1 / 35608 FlyBaseID:FBgn0033121 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_564384.1 Gene:CYP97A3 / 840067 AraportID:AT1G31800 Length:595 Species:Arabidopsis thaliana


Alignment Length:459 Identity:99/459 - (21%)
Similarity:178/459 - (38%) Gaps:86/459 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 AQDALQDIYTAYKGRAPFVGFYACL-------------KPFILALDLKLVHQIIFTDAGHFTSRG 107
            |:.::|    |.:..|.|:..|...             |.|::..|..:...|:..:|..: |:|
plant   116 AKGSIQ----AVRNEAFFIPLYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNAKAY-SKG 175

  Fly   108 LYSNPSGEPLSHNLLQLDGHKWRSLHAKSAEVFTPANMQKLLVRL----SQISSRIQRDLGEKSL 168
            :.:......:...|:..||..||    :......||..||.:..:    .:.|.|:.:.|...:|
plant   176 ILAEILDFVMGKGLIPADGEIWR----RRRRAIVPALHQKYVAAMISLFGEASDRLCQKLDAAAL 236

  Fly   169 --QTINISELVGAYNTDVMASMAFGLVGQDNVEFAK----------------------------W 203
              :.:.:..|......|::....|      |.:|..                            |
plant   237 KGEEVEMESLFSRLTLDIIGKAVF------NYDFDSLTNDTGVIEAVYTVLREAEDRSVSPIPVW 295

  Fly   204 TRNYWADFRMWQAYLALEFPLIARLLQYKSYAEPATAYFQKVALSQLQLHRR--RDRQPLQTFLQ 266
            ....|.|....|..:|....||...|.     :......:.|...:||.|..  .:|.|......
plant   296 DIPIWKDISPRQRKVATSLKLINDTLD-----DLIATCKRMVEEEELQFHEEYMNERDPSILHFL 355

  Fly   267 LYSN---AEKPLTDIEIAGQAFGFVLAGLGPLNATLAFCLYELARQPEVQDRTRLEINKALEEHG 328
            |.|.   :.|.|.|     .....::||.....|.|.:..|.|..:|.|..:.:.|::..:.:. 
plant   356 LASGDDVSSKQLRD-----DLMTMLIAGHETSAAVLTWTFYLLTTEPSVVAKLQEEVDSVIGDR- 414

  Fly   329 GQVTPECLRELRYTKQVLNETLRLHTPHPFLLRRATKEFEVPGSVFVIAKGNNVLIPTAAIHMDP 393
             ..|.:.:::|:||.:|:||:|||:...|.|:||:. :.::.|. :.|.:|.::.|....:|..|
plant   415 -FPTIQDMKKLKYTTRVMNESLRLYPQPPVLIRRSI-DNDILGE-YPIKRGEDIFISVWNLHRSP 476

  Fly   394 GIYENPQRFYPERFE---EQARRSRPAAAFLPFGDGLRGCIAARFAEQQLLVGLVALLRQHRY-- 453
            ..:::.::|.|||:.   .....:....::||||.|.|.||...||..:.:|.:..|:|:..:  
plant   477 LHWDDAEKFNPERWPLDGPNPNETNQNFSYLPFGGGPRKCIGDMFASFENVVAIAMLIRRFNFQI 541

  Fly   454 APSA 457
            ||.|
plant   542 APGA 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6u1NP_001286149.1 p450 38..475 CDD:299894 99/459 (22%)
CYP97A3NP_564384.1 PLN02738 1..595 CDD:215393 99/459 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.