DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6u1 and CYP705A12

DIOPT Version :9

Sequence 1:NP_001286149.1 Gene:Cyp6u1 / 35608 FlyBaseID:FBgn0033121 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_199072.1 Gene:CYP705A12 / 834265 AraportID:AT5G42580 Length:499 Species:Arabidopsis thaliana


Alignment Length:409 Identity:87/409 - (21%)
Similarity:148/409 - (36%) Gaps:100/409 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PFILALDLKLVHQIIFT--------------DAGHFTSRGLYSNPSGEPLSHNLLQLDGHKWRSL 132
            |.:|.....:.:::..|              |:..|.|.|..:.|.|:            .|:.:
plant    83 PMVLVSSASMAYEVFRTNDVNVSYRFVPVNKDSLVFGSSGFVTAPYGD------------YWKFM 135

  Fly   133 HAK-SAEVFTPANMQKLLVRLSQISSRIQRDLGEKS--LQTINISELVGAYNTDVMASMAFGLVG 194
            ... |.::..|..::......::...|...||..|:  .:::.|.::......:::..|:.|...
plant   136 KKLISTKLLRPHALELSKGNRAEELRRFCLDLQGKARKKESVEIGKVALKLTNNIICRMSMGRSC 200

  Fly   195 QDNVEFAKWTRNYWADFRMWQAYLALEFPLIARLLQYKSYAEPATAYFQKVALSQL--------- 250
            .:....|:                      .||.|..||:|.....:|..:....:         
plant   201 SEKNGVAE----------------------RARELVNKSFALSVKLFFSNMFRKDIMGVSREFDE 243

  Fly   251 -----------QLHRRRDRQPLQTFLQLYSN--AEKPLTDIEIAGQAFGFVLAGLGPLNATLAFC 302
                       .|...:||..:...|:.|.|  ||..:|..:|........|.|......|:.:.
plant   244 FLERILVEHEENLEGDQDRDMIDHLLEAYRNEEAEYKITRKQIKSLIVEIFLGGTDSSAQTIQWT 308

  Fly   303 LYELARQPEVQDRTRLEINKALEEHGGQ--VTPECLRELRYTKQVLNETLRLHTPHPFLLR---- 361
            :.|:...|.|.::.|.||:..:   ||:  :....|..|.|.:.|:.|.||||...|.|||    
plant   309 MAEILNNPGVLEKLRAEIDSVV---GGKRLIQESDLPNLPYLQAVVKEGLRLHPSAPVLLRVFGE 370

  Fly   362 -RATKEFEVPGSVFVIAKGNNVLIPTAAIHMDPGIYENPQRFYPERF--------EEQARRSRPA 417
             ...|||.||       :...:::...|::.||..:|:|..|.||||        ||:.|..  |
plant   371 SCEVKEFYVP-------EKTTLVVNLYAVNRDPDSWEDPDMFKPERFLVSSISGDEEKIREQ--A 426

  Fly   418 AAFLPFGDGLRGCIAARFA 436
            ..::.||.|.|.|.|.:.|
plant   427 VKYVTFGGGRRTCPAVKLA 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6u1NP_001286149.1 p450 38..475 CDD:299894 87/409 (21%)
CYP705A12NP_199072.1 CYP93 72..490 CDD:410748 87/409 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.