DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6u1 and CYP71A27

DIOPT Version :9

Sequence 1:NP_001286149.1 Gene:Cyp6u1 / 35608 FlyBaseID:FBgn0033121 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_193757.3 Gene:CYP71A27 / 827771 AraportID:AT4G20240 Length:451 Species:Arabidopsis thaliana


Alignment Length:367 Identity:75/367 - (20%)
Similarity:136/367 - (37%) Gaps:95/367 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 DLKLVHQ------IIFTDAGHFTSRGLYSNPSGEPLSHNLLQLDGHKWRSLHA------------ 134
            |||..::      .||.:.|    |.:...|.||            .|:|:.:            
plant    94 DLKFANRPKSKAINIFMEGG----RDIIFGPYGE------------DWKSMKSLGVVHLLNNKMV 142

  Fly   135 KSAEVFTPANMQKLLVRLSQISSRIQRDLGEKSLQTINISELVGAYNTDVMASMAFG-------- 191
            :|.|......::.:..:|.:.||         |..::|:|:|:.....|::..:..|        
plant   143 RSFENLREEEIKVMTEKLEEASS---------SSSSVNLSKLLMTLTNDIICRITLGRKYNEEEG 198

  Fly   192 ------LVGQDNVEFAKWTRNYWADFRMWQAYLALEFPLIARLLQYKSYAEPATAYFQKVAL--- 247
                  ||...:..|.|:   ::.||          .|.:|.:.......:.......|:..   
plant   199 GIDIKNLVMTSSEFFGKF---FFGDF----------IPSLAWIDWISGIDDKMKDINNKLDCFLD 250

  Fly   248 SQLQLHRRRDRQPLQTFLQLYSNAEKPLTDIEIAGQAFGF------------VLAGLGPLNATLA 300
            |.:|.|...|.:....|:.:....:|..|      :.|.|            ..:|.....:.|.
plant   251 SMVQEHVDADHKEPSDFIDMLLLIQKDKT------KRFKFDRSDLILILKDMFFSGTATTASQLE 309

  Fly   301 FCLYELARQPEVQDRTRLEINKALEEHGGQVTPECLRELRYTKQVLNETLRLHTPHPFLLRRATK 365
            :.:.||.|.||...:.:.||| :...|...||.:.:.::.|...|:.|.||||...|.|.|..::
plant   310 WTMTELMRHPECMKKLQDEIN-SFSTHNLNVTEKEVEKMNYLHCVIKEGLRLHPSGPLLFRLPSE 373

  Fly   366 EFEVPGSVFVIAKGNNVLIPTAAIHMDPGIYE-NPQRFYPER 406
            :.::.|  :.|:.|.:|:|...|:..:|.|:. :...:.|||
plant   374 DVQLKG--YDISAGTHVIINAWALQRNPAIWGLDANEYRPER 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6u1NP_001286149.1 p450 38..475 CDD:299894 75/367 (20%)
CYP71A27NP_193757.3 p450 33..439 CDD:299894 75/367 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.