DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6u1 and CYP705A9

DIOPT Version :9

Sequence 1:NP_001286149.1 Gene:Cyp6u1 / 35608 FlyBaseID:FBgn0033121 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_180269.1 Gene:CYP705A9 / 817243 AraportID:AT2G27010 Length:498 Species:Arabidopsis thaliana


Alignment Length:436 Identity:89/436 - (20%)
Similarity:165/436 - (37%) Gaps:88/436 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GNIKGVVSGKRHAQDALQDIYTAYKGRAPFVGFYACLKPFILALDLKLVHQIIFTDAGHFTSRGL 108
            |::..::|...|.  :||.:.:.|   .|.:..:....|.:|.....:.::|..|...:.:||..
plant    46 GHLHHLLSLFMHR--SLQKLSSKY---GPLLYLHVFNVPILLVSSPSIAYEIFRTQDVNVSSRDF 105

  Fly   109 YSNPS---------GEPLSHNLLQLDGHKWRSLHAKSAEVFTPANMQKLLVRLSQISSRIQRDLG 164
            .:|..         |...|..|....|||      ||.:.....|:....|:...:      ::.
plant   106 PTNEGSLLFGSFGFGTAPSSGLKHSRGHK------KSVQRSYYLNLLDKAVKKESV------EIA 158

  Fly   165 EKSLQTIN--ISELV---GAYNTDVMASMAFGLVGQDNVEFAKWTRNYWADFRMWQAYLALEFPL 224
            |::::.:|  :.:::   .....:..|....|||.:.:....|:                    :
plant   159 EEAMKLVNNTVCQMIMGRSCSEENGEAERVRGLVTKTDALTKKF--------------------I 203

  Fly   225 IARLLQ----------YKSYAEPATAYFQKVALSQL--------QLHRRRDRQPLQTFLQLYSN- 270
            :|.:|:          :|.....|:..|.:|....|        :.|:..|.  :...|::|.: 
plant   204 LAGILRKPLQKIGISLFKKELMDASCKFNEVLEKILVEYKEKVEEHHQGTDM--MDKLLEVYGDE 266

  Fly   271 -AEKPLTDIEIAGQAFGFVLAGLGPLNATLAFCLYELARQPEVQDRTRLEINKALEEHGGQ---V 331
             ||..:|...|.........||.......:.:.:.|:.....:.:|.|.||:..:    |:   :
plant   267 KAEYKITRDHIKSLFVDLFFAGTDTWTHAIQWIMAEIINNSYILERLREEIDSVV----GKTRLI 327

  Fly   332 TPECLRELRYTKQVLNETLRLHTPHPFLLRRATKEFEVPGSVFVIAKGNNVLIPTAAIHMDPGIY 396
            ....|..|...:..:.|.||||.|.|.:||...:...:.|  |.:.:...:::...|:..||..:
plant   328 QETDLPNLPCLQATVKEGLRLHPPVPLVLRTFKEGCTIGG--FYVPEKTTLVVNGYAMMRDPEYW 390

  Fly   397 ENPQRFYPERFEEQARRSR------PAAAFLPFGDGLRGCIAARFA 436
            |:||.|.||||...:|.|:      ....:||||:|.|.|..|..|
plant   391 EDPQEFKPERFLASSRSSQNDEIRDELLKYLPFGNGRRACPGANLA 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6u1NP_001286149.1 p450 38..475 CDD:299894 89/436 (20%)
CYP705A9NP_180269.1 p450 46..486 CDD:299894 89/436 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.