DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6u1 and AT3G32047

DIOPT Version :9

Sequence 1:NP_001286149.1 Gene:Cyp6u1 / 35608 FlyBaseID:FBgn0033121 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001030796.1 Gene:AT3G32047 / 3769237 AraportID:AT3G32047 Length:502 Species:Arabidopsis thaliana


Alignment Length:443 Identity:96/443 - (21%)
Similarity:170/443 - (38%) Gaps:100/443 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GNIKGVVSGKRHAQDALQDIYTAYKGRAPFVGFYACLKPFILALDLKLVHQIIFTDAGHFTSRGL 108
            |::..::|...|  .:.|:|.:.| |....:.|:..  |.:|.....:.::|..|...:.:|.| 
plant    53 GHLHLILSTLPH--KSFQNISSKY-GPLLLLRFFNV--PVVLKSSANVAYEIFKTHDVNISSHG- 111

  Fly   109 YSNPSGEPL----SHNLLQLDGHKWRSL-HAKSAEVFTPANMQKLLVRLSQISSRIQRDLGEKSL 168
             ..|..|.|    |..::...|:.||.: .....::|.|..:::|            |.:.|..|
plant   112 -HPPIDECLFFGSSSFVVAPYGYYWRLMKKLMVTKLFGPQALERL------------RHVREDEL 163

  Fly   169 QTINISELVGAYNTDVMASMAFGLVGQDNVEFAKWTRNYWADFRMWQAYLALEFPLIARLLQYKS 233
            :         .::|::::....|...|...|..|.|.|......|.::.|. |....||:   :.
plant   164 E---------RFHTNLLSKEMKGETVQIAKEAIKLTNNSVCKMIMGRSCLE-ENGDAARV---RG 215

  Fly   234 YAEPATAYFQKVALSQLQLHR------------------------------RRDRQP-------L 261
            ......|..:|:.|:|: |.|                              ..|.:|       :
plant   216 LVTETFALVKKIFLTQV-LRRLFEILGISLFKKEILGVSRKFDEFLEKILVEHDEKPDFQGGDMM 279

  Fly   262 QTFLQLY--SNAEKPLTDIEIAGQAFGFVLAGLGPLNATLAFCLYELARQPEVQDRTRLEIN--- 321
            ...|..|  .|||..:|...|.......:|.|......|:.:.:.|:..:|.:.::.|.|::   
plant   280 DVLLAAYRDENAEYKITRNHIKSLFAELILGGTDTSAQTIEWTMAEIINKPNILEKLRKELDSVV 344

  Fly   322 ---KALEEHGGQVTPECLRELRYTKQVLNETLRLHTPHPFLLRRATKEFEVPGSVFVIAKGNNVL 383
               :.:||       :.|..|.|.:.|:.|.||||.|.|...|:..:...:.|  :.:.|...::
plant   345 GKTRLIEE-------KDLPNLPYLQSVVKEGLRLHPPAPVFGRKVLEGCTIKG--YYVPKNTALV 400

  Fly   384 IPTAAIHMDPGIYENPQRFYPERF------EEQARRSRPAAAFLPFGDGLRGC 430
            :...|:..||..:|:|..|.||||      :|:.|...  ..::|||.|.|||
plant   401 VNAYAVMRDPHYWEDPDEFKPERFLTTSSKKEEEREQE--LKYIPFGSGRRGC 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6u1NP_001286149.1 p450 38..475 CDD:299894 96/443 (22%)
AT3G32047NP_001030796.1 p450 59..496 CDD:299894 95/437 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.