DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6u1 and CYP705A28

DIOPT Version :9

Sequence 1:NP_001286149.1 Gene:Cyp6u1 / 35608 FlyBaseID:FBgn0033121 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001154631.1 Gene:CYP705A28 / 3768880 AraportID:AT3G20935 Length:348 Species:Arabidopsis thaliana


Alignment Length:266 Identity:66/266 - (24%)
Similarity:106/266 - (39%) Gaps:53/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 QKVALSQLQLHRRRDRQPLQTF-LQLYSNAEKPLTDIEIAGQAFGFVLAGLGPLNATLA--FCLY 304
            |.|.|...::...:.|:|...| ...|||....|.::.:||..           .:.||  :.:.
plant    98 QNVNLCIKRVSNTKARKPPILFRYGKYSNNSLLLQELLVAGTD-----------TSALATQWTMA 151

  Fly   305 ELARQPEVQDRTRLEINKALEEHGGQ--VTPECLRELRYTKQVLNETLRLHTPHPFLLRRATKEF 367
            ||...|.:.:|.|.||...:   |..  :....|..|.|.:.|:.|.||||.|....:|.:.:..
plant   152 ELINNPTILERLREEIESVV---GNTRLIQETDLSNLPYLQSVVKEGLRLHPPASISVRMSQERC 213

  Fly   368 EVPGSVFVIAKGNNVLIPTAAIHMDPGIYENPQRFYPERF------EEQARRSRPAAAFLPFGDG 426
            |:.|  |.|.:...:::.|.||..||..:|:|:.|.||||      |::.........::||..|
plant   214 ELGG--FYIPEKTLLVVNTYAIMRDPNFWEDPEEFKPERFITSSRSEQEDEMREEVLKYIPFSAG 276

  Fly   427 LRGCIAARFAEQQLLVGLVALLRQHRYAPSAE---------------------TSIPVEYDNRRL 470
            .|||..:..|...|.:.:..:::...:....|                     |.:|     |.|
plant   277 RRGCPGSNLAYVSLGIAIGVMVQCFDWRIKGEKVNMSETAGTIMLAMAQPLKCTPVP-----RTL 336

  Fly   471 LLMPKS 476
            .|:|.|
plant   337 NLLPSS 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6u1NP_001286149.1 p450 38..475 CDD:299894 64/263 (24%)
CYP705A28NP_001154631.1 p450 <13..346 CDD:299894 66/266 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.