DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6u1 and Cyp6a21

DIOPT Version :9

Sequence 1:NP_001286149.1 Gene:Cyp6u1 / 35608 FlyBaseID:FBgn0033121 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster


Alignment Length:510 Identity:174/510 - (34%)
Similarity:268/510 - (52%) Gaps:44/510 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLTALGALSVVYALVKF--SLGYWKRRGILHEKPKFLWGNIKGVVSGKRHAQDALQDIYTAY--- 67
            |||||.|| |.|.|:|:  ::.:|:..||..|:|..|.|::|||.:.:     :..:|:|:|   
  Fly     7 LLTALLAL-VGYLLMKWRSTMRHWQDLGIPCEEPHILMGSMKGVRTAR-----SFNEIWTSYYNK 65

  Fly    68 -KGRAPFVGFYACLKPFILALDLKLVHQIIFTDAGHFTSRGLYSNPSGEPLSHNLLQLDGHKWRS 131
             :|..||.|||...:|.:..|:..|..||:..:...||.||.:.||..:|||..|..|||.|||:
  Fly    66 FRGSGPFAGFYWFRRPAVFVLETSLAKQILIKEFNKFTDRGFFHNPEDDPLSGQLFLLDGQKWRT 130

  Fly   132 LHAKSAEVFTPANMQKLLVRLSQISSRIQRDLGEKSLQT--INISELVGAYNTDVMASMAFGL-- 192
            :..|.:..||...|:.:...:.::::......|:...::  :.:.||:..:.|||:.:.|||:  
  Fly   131 MRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAKSPVVEVRELLARFTTDVIGTCAFGIEC 195

  Fly   193 --VGQDNVEFAKWTRNYWADFRMWQAYLAL--EFPLIARLLQYKSYAEPATAYFQK-----VALS 248
              :...:.||.:..|....:.|:....:..  .||.:||.|..|..|||...:|.:     ||..
  Fly   196 SSLKDPDAEFREMGRRSLTEQRLGPVGIGFVNSFPNLARRLHMKMTAEPIERFFMRIVRETVAFR 260

  Fly   249 QLQLHRRRDRQPLQTFL-QLYSNAEKP-----------LTDIEIAGQAFGFVLAGLGPLNATLAF 301
            :....||.|      |: ||.....||           ||..|||.|||.|..||....:.|:.|
  Fly   261 EQNNIRRND------FMDQLIDLKNKPLMVSQSGESVNLTIEEIAAQAFVFFAAGFETSSTTMGF 319

  Fly   302 CLYELARQPEVQDRTRLEINKALEEHGGQVTPECLRELRYTKQVLNETLRLHTPHPFLLRRATKE 366
            .|||||:..::|:|.|.|..:.:|:..|::..|.:::|.|..||::|||||:|..|.|.|...::
  Fly   320 ALYELAQNQDIQNRVRKECQEVIEKCNGELNYESMKDLVYLDQVVSETLRLYTVLPVLNRECLED 384

  Fly   367 FEVPG-SVFVIAKGNNVLIPTAAIHMDPGIYENPQRFYPERFEEQARRSRPAAAFLPFGDGLRGC 430
            :|||| ..:||.||..||||..|:|.|..:|.||..|.|:.|..:..:.|.:..:||||||.|.|
  Fly   385 YEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNC 449

  Fly   431 IAARFAEQQLLVGLVALLRQHRYAPSAETSIPVEYDNRRLLLMPKSDIKLSVERV 485
            |..||.:.|..:||..|::..:::...:|:||:.|:....|:...|.|.|..|||
  Fly   450 IGMRFGQMQARIGLALLIKDFKFSVCEKTTIPMTYNKEMFLIASNSGIYLKAERV 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6u1NP_001286149.1 p450 38..475 CDD:299894 153/466 (33%)
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 156/474 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471845
Domainoid 1 1.000 151 1.000 Domainoid score I1386
eggNOG 1 0.900 - - E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1621
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
98.900

Return to query results.
Submit another query.