DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6u1 and Cyp310a1

DIOPT Version :9

Sequence 1:NP_001286149.1 Gene:Cyp6u1 / 35608 FlyBaseID:FBgn0033121 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_609891.1 Gene:Cyp310a1 / 35115 FlyBaseID:FBgn0032693 Length:492 Species:Drosophila melanogaster


Alignment Length:529 Identity:121/529 - (22%)
Similarity:220/529 - (41%) Gaps:100/529 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLTALGALSVVYALVKFSLGYWKRRGILHEKPKFLWGNIKGVVSGKRHAQDALQDIYTAYKGRAP 72
            ||..:...|.|:..|:....:|:|||...||....|..::.....:....:|:.:.|.:.|.|  
  Fly     3 LLLPILLYSAVFLSVRHIYSHWRRRGFPSEKAGITWSFLQKAYRREFRHVEAICEAYQSGKDR-- 65

  Fly    73 FVGFYACLKPFILALDLKLVHQIIFTDAGHFTSRGLYSNPSGEPLSHNLLQLD---GHKWRSLHA 134
            .:|.|...:|.:|..:::|...|:....|||:.                |:.|   |::..:|..
  Fly    66 LLGIYCFFRPVLLVRNVELAQTILQQSNGHFSE----------------LKWDYISGYRRFNLLE 114

  Fly   135 KSAEVFTPANMQKLLVRLSQISSRIQRDL----GEKSLQTINISELVGAYNTDVMASMAFGLVGQ 195
            |.|.:|....:.::..::.::...:...|    |:...|.::|.:.:..|:.:::|::.:||.  
  Fly   115 KLAPMFGTKRLSEMFGQVQKVGDHLIHHLLDRQGQGCPQEVDIQQKLRVYSVNIIANLIYGLD-- 177

  Fly   196 DNVEFAKWTRNYWADFRMWQAYL-----ALEFPLIARLLQYKSYAEPATAYFQKVALSQLQLHR- 254
                    ..|:..:..:..:||     :::...:.||.|..||    |...:.:....::|.. 
  Fly   178 --------INNFEHEDHILTSYLSHSQASIQSFTLGRLPQKSSY----TYRLRDLIKQSVELRED 230

  Fly   255 ----RRD-RQPLQTF------------LQLYSNAEKPLTDIEIAGQAFGFVLAGLGPLNATLAFC 302
                |:| .|.|..|            |:..::|:|.|:...:|..|...:...|..:.:|:.|.
  Fly   231 HGLIRKDILQLLVRFRNGNEVSGDKWQLEPINDADKLLSIKRLAKVAEDLLKVSLDAVASTVTFT 295

  Fly   303 LYELARQPEVQDRTRLEINKALEEHGGQVTPECLRELRYTKQVLNETLRLHTPHPFLLRRATKEF 367
            |.|:.::|.:.::.|.|| |.|....||:..|.|..|||....|.||||.:.|.|.:.|...|.:
  Fly   296 LLEILQEPLIVEKLRAEI-KELSNENGQLKFEELNGLRYMDMCLKETLRKYPPLPIIERVCRKSY 359

  Fly   368 EVPGSVFVIAKGNNVLIPTAAIHMDPGIYENPQRFYPERFEE------QARRSRPAAAFLPFGDG 426
            .:|.|.|.|.:|..:::|..|:|.|...:..|.::.|.||.:      |......:..|:.||.|
  Fly   360 SLPNSKFTIDEGKTLMVPLLAMHRDEKYFSEPMKYKPLRFLQTANDVGQCEDKTKSNVFIGFGIG 424

  Fly   427 LRGCIAARFAEQQLLVGLVALLR----------------QHRYAPSAETSIPVEYDNRRLLLMPK 475
            ...|:...||:..:.|.|:.||:                .||.||...|               |
  Fly   425 GSQCVGQNFAKLVIKVALIKLLQNFHLELDANQVKTLKVSHRPAPFIHT---------------K 474

  Fly   476 SDIKLSVER 484
            ..:|:.::|
  Fly   475 DGLKVKLKR 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6u1NP_001286149.1 p450 38..475 CDD:299894 108/488 (22%)
Cyp310a1NP_609891.1 p450 69..454 CDD:299894 96/415 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461206
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 180 1.000 Inparanoid score I2666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
87.900

Return to query results.
Submit another query.