DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Serpinb6c

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001369781.1 Gene:Serpinb6c / 97848 MGIID:2145481 Length:379 Species:Mus musculus


Alignment Length:389 Identity:124/389 - (31%)
Similarity:199/389 - (51%) Gaps:40/389 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AQFASQLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTADELKLGLGLEGAGKTEVAEKLD 97
            |.||..|...|.:.:| :|:..||.||.:.|.:..|||:|:||.::...|.|   ||...:|..|
Mouse    10 ATFALNLLKILGEDRS-KNVFLSPISISSALVMVLLGAKGTTAIQITQALSL---GKCSSSEDGD 70

  Fly    98 -----QLLAKGQWEKASGDEDVPK------LKYANRIFVTQRFKLTQTYQDLVSKNFAAAAENVN 151
                 |||.          .:|.|      ||.|||:|..:.|.:..:::|...|.:.|..|.::
Mouse    71 VHQGFQLLL----------SEVNKTGTQYSLKAANRLFGEKTFDILASFKDSCHKFYEAEMEELD 125

  Fly   152 FTQKADTAK-HINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSSFPDYATYASDF 215
            |....:.:: |||:||.::|..:||:|::|.::.::|..|||||:|||..|:..|....|....|
Mouse   126 FKGATEQSRQHINTWVAKKTEDKIKELLSPGTIHSNTPLILVNAVYFKGKWEKQFNKEDTREMPF 190

  Fly   216 VNHGGRKVSVDTMSQEDYFRFGELTELKAKVVELPYTGTDIVFLIILPQEEQGLAIVEEKLMGID 280
            ......:..|..|.|:..|:...:.|:..|::.|||.|.::..:|:||.|...|:.||:::....
Mouse   191 KVSKNEEKPVQMMFQKSTFKMTYVEEISTKILLLPYVGNELNMIIMLPDEHVELSTVEKEITHEK 255

  Fly   281 LNEIS--SQLRRRKVRVQLPKFKFEFDVPLQAALEELGIKKLFSPG-ANLSSLYQGSEPLRISEV 342
            ..|.:  .:::..||.|.||.||.|.:..::..|.:||:...|..| |:.|.: ...:.|.:|.|
Mouse   256 FIEWTRLDRMKGEKVEVFLPWFKLEENYDMKDVLCKLGMTDAFEEGRADFSGI-SSKQGLFLSNV 319

  Fly   343 KHKAIIEVNEKGTTASGATFI--KVSVESLTIGEEVFEFIADHPFFFAIKDAQNT--LFLGHVS 402
            .||:::||||:|:.|:.||.|  |.|..|...      |..:.||.|.|:..:..  ||||.:|
Mouse   320 IHKSVVEVNEEGSEATAATTIVLKGSSRSTPC------FCVNRPFIFFIQHIKTNEILFLGRLS 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 123/386 (32%)
Serpinb6cNP_001369781.1 serpin 2..379 CDD:422956 124/389 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.