DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and SERPINB11

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001357404.1 Gene:SERPINB11 / 89778 HGNCID:14221 Length:392 Species:Homo sapiens


Alignment Length:401 Identity:123/401 - (30%)
Similarity:197/401 - (49%) Gaps:52/401 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QFASQLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTADELKLGLGLEGAGKTEVAEKLDQ 98
            :|...:|.:|..:..|.||.||..|:...|::..|||.|.|.::|:..|        ..:..:|.
Human    10 EFCLDVFKELNSNNIGDNIFFSSLSLLYALSMVLLGARGETEEQLEKVL--------HFSHTVDS 66

  Fly    99 LLAKGQWEKASGDEDVPK--------------------------LKYANRIFVTQRFKLTQTYQD 137
            |        ..|.:|.||                          |..|||::.|:.....|.|..
Human    67 L--------KPGFKDSPKCSQAGRIHSEFGVEFSQINQPDSNCTLSIANRLYGTKTMAFHQQYLS 123

  Fly   138 LVSKNFAAAAENVNFTQKA-DTAKHINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADW 201
            ...|.:.|..:.|:|.|.. :|.|.||:|||.:|:.::.:|....::|..:..:||||||||..|
Human   124 CSEKWYQARLQTVDFEQSTEETRKTINAWVENKTNGKVANLFGKSTIDPSSVMVLVNAIYFKGQW 188

  Fly   202 QSSFPDYATYASDFVNHGGRKVSVDTMSQEDYFRFGELTELKAKVVELPYTGTDIVFLIILPQEE 266
            |:.|....|..|.|....|:.|:|:.|.|...|:...:.|.:.:|:||||....:..:|:||...
Human   189 QNKFQVRETVKSPFQLSEGKNVTVEMMYQIGTFKLAFVKEPQMQVLELPYVNNKLSMIILLPVGI 253

  Fly   267 QGLAIVEEKLMGIDLNE--ISSQLRRRKVRVQLPKFKFEFDVPLQAALEELGIKKLFSP-GANLS 328
            ..|..:|::|.....:|  .||.:..|:|.|.||:||.|....|.:.|:.||:..||:. .|:||
Human   254 ANLKQIEKQLNSGTFHEWTSSSNMMEREVEVHLPRFKLETKYELNSLLKSLGVTDLFNQVKADLS 318

  Fly   329 SLYQGSEPLRISEVKHKAIIEVNEKGTTASGATFIKVSVESLTIGEEVFEFIADHPFFFAIKDAQ 393
            .: ..::.|.:|:..||:.::|:|:||.|:.||...::|:||.:..   :|.|:|||.|.|:...
Human   319 GM-SPTKGLYLSKAIHKSYLDVSEEGTEAAAATGDSIAVKSLPMRA---QFKANHPFLFFIRHTH 379

  Fly   394 -NT-LFLGHVS 402
             || ||.|.::
Human   380 TNTILFCGKLA 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 123/398 (31%)
SERPINB11NP_001357404.1 ovalbumin_like 4..392 CDD:239014 123/401 (31%)
RCL. /evidence=ECO:0000250 341..365 9/26 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.