DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and SERPINH1

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001193943.1 Gene:SERPINH1 / 871 HGNCID:1546 Length:418 Species:Homo sapiens


Alignment Length:425 Identity:99/425 - (23%)
Similarity:169/425 - (39%) Gaps:52/425 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLLLLQGLNLAMANTLNYSKSPAG--------------------EAQFASQLFGQLAKSQSGRNI 52
            |||||....|..|......|.||.                    .|..|..|:..:||.|:..||
Human     3 SLLLLSAFCLLEAALAAEVKKPAAAAAPGTAEKLSPKAATLAERSAGLAFSLYQAMAKDQAVENI 67

  Fly    53 VFSPSSIRTGLALAYLGAEGSTADELKLGLGLE-------GAGKTEVAEKLDQLLAKG-QWEKAS 109
            :.||..:.:.|.|..||.:.:||.:.|..|..|       .||..|:...|....|:. .|    
Human    68 LVSPVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEEVHAGLGELLRSLSNSTARNVTW---- 128

  Fly   110 GDEDVPKLKYANRIFVTQRFKLTQTYQDLVSKNFAAAAENVNFTQKADTAKHINSWVEEQTHQQI 174
                    |..:|::..........:.....:::......:||..|....:.||.|..:.|..::
Human   129 --------KLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDKRSALQSINEWAAQTTDGKL 185

  Fly   175 KDLIAPESLDADTSAILVNAIYFKADWQSSFPDYATYASDFVNHGGRKVSVDTMSQEDYFRFGEL 239
            .::  .:.::....|:||||::||..|...|.........|:......|.|..|.:...:.:.:.
Human   186 PEV--TKDVERTDGALLVNAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVMMMHRTGLYNYYDD 248

  Fly   240 TELKAKVVELPYTGTDIVFLIILPQEEQGLAIVEEKLMGIDLNEISSQLRRRKVRVQLPKFKFEF 304
            .:.|.::||:|........:|::|...:.|..:|:.|....|.....:::::.|.:.|||...|.
Human   249 EKEKLQIVEMPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKIWMGKMQKKAVAISLPKGVVEV 313

  Fly   305 DVPLQAALEELGIKKLFSPG-ANLSSLYQGSEPLRISEVKHKAIIEVNEKGTTASGATFIKVSVE 368
            ...||..|..||:.:..... |:||.: .|.:.|.::.|.|....|::..|.......:.:..:.
Human   314 THDLQKHLAGLGLTEAIDKNKADLSRM-SGKKDLYLASVFHATAFELDTDGNPFDQDIYGREELR 377

  Fly   369 SLTIGEEVFEFIADHPFFFAIKDAQ--NTLFLGHV 401
            |..:      |.|||||.|.::|.|  :.||:|.:
Human   378 SPKL------FYADHPFIFLVRDTQSGSLLFIGRL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 89/400 (22%)
SERPINH1NP_001193943.1 serpinH1_CBP1 36..417 CDD:381003 89/392 (23%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 415..418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.