DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and AT1G63280

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_176517.1 Gene:AT1G63280 / 842634 AraportID:AT1G63280 Length:120 Species:Arabidopsis thaliana


Alignment Length:129 Identity:36/129 - (27%)
Similarity:58/129 - (44%) Gaps:27/129 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 FTQKA-DTAKHINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSSFPDYATYASDF 215
            |..|| ...:.:|.|..:.|:..|.||:...|:.::|..:..||:|||..|::.|...:|..::|
plant     5 FVLKAVQVRQELNKWASDHTNGLIIDLLPRGSVKSETVQVYGNALYFKGAWENKFDKSSTKDNEF 69

  Fly   216 VNHGGRKVSVDTMSQEDYFRFGELTELKA----KVVELPYTGTDIVFLIILPQEEQGLAIVEEK 275
              |.|::|.|      .:.|..|...:.|    ||:.|||              :|||...:.|
plant    70 --HQGKEVHV------PFMRSYESQYIMACDGFKVLGLPY--------------QQGLDDTKRK 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 36/129 (28%)
AT1G63280NP_176517.1 serpin <5..>120 CDD:422956 36/129 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.