DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and AT1G51330

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_175544.1 Gene:AT1G51330 / 841556 AraportID:AT1G51330 Length:193 Species:Arabidopsis thaliana


Alignment Length:206 Identity:45/206 - (21%)
Similarity:71/206 - (34%) Gaps:77/206 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 INSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSSFPDYATYASDFVNHGGRKVSVD 226
            :|||....|:..||:|:.|.|:...|..|..||:|||..|::.|....|....|....|::|.|.
plant    39 VNSWALRHTNGLIKNLLPPGSVTNQTIKIYGNALYFKGAWENKFGKSMTIHKPFHLVNGKQVLVP 103

  Fly   227 TMSQEDYFRFGELTELKAKVVELPYTGTDIVFLIILPQEEQGLAIVEEKLMGIDLNEISSQLRRR 291
            .|  :.|    |...:||      |.|..:            |.|::.:   :|..:.|.|    
plant   104 FM--KSY----ERKYMKA------YNGFKV------------LRILQYR---VDYKDTSRQ---- 137

  Fly   292 KVRVQLPKFKFEFDVPLQAALEELGIKKLFSPGANLSSLYQGSEPLRISEVKHKAIIEVNEKGTT 356
                      |..|:.|                                    ..:||::|:...
plant   138 ----------FSIDMDL------------------------------------NVLIEIDEESAE 156

  Fly   357 ASGATFIKVSV 367
            |:.||.:..:|
plant   157 AAAATALACTV 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 45/206 (22%)
AT1G51330NP_175544.1 SERPIN <11..>139 CDD:294093 35/140 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.