DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Serpina9

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001348839.1 Gene:Serpina9 / 71907 MGIID:1919157 Length:418 Species:Mus musculus


Alignment Length:415 Identity:123/415 - (29%)
Similarity:210/415 - (50%) Gaps:33/415 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLQGL-------------NLAMANTLNYSKSPAGE-----AQFASQLFGQLAKSQSGRNIVFS 55
            :|||.|.             |...::..:..|:||.:     .:|:..|:.:||:...|:||:||
Mouse     9 VLLLVGFCAPIFCMLSSNPYNQESSHLPSMKKNPASQVSPSNTRFSFLLYQRLAQENPGQNILFS 73

  Fly    56 PSSIRTGLALAYLGAEGSTADELKLGLGLEGAGKTEVAEKLD-QLLAKGQWEKASGDEDVPKLKY 119
            |.||.|.||:..|||..:|..::...||......:|....:. :.|.:...:...|.|    |:.
Mouse    74 PVSISTSLAMLSLGARSATKTQILRTLGFNFTWVSEPTIHMGFEYLVRSLNKCHQGRE----LRM 134

  Fly   120 ANRIFVTQRFKLTQTYQDLVSKNFAAAAENVNFTQKADTAKHINSWVEEQTHQQIKDLIAPESLD 184
            .:.:|:.:..:|..|:.|.|.|.:.|...:.:|:..|.....|||:||::|..::.|:|  :.||
Mouse   135 GSVLFIRKELQLQATFLDRVKKLYGAKVFSEDFSNAATAQAQINSYVEKETKGKVVDVI--QDLD 197

  Fly   185 ADTSAILVNAIYFKADWQSSFPDYATYAS-DFVNHGGRKVSVDTMSQEDYFRFGELTELKAKVVE 248
            :.|:.:|||.|:|||:|...|....|..| .|:...|..|.|..|.|.:.|.||...||...:::
Mouse   198 SQTAMVLVNHIFFKANWTQPFSTANTNKSFPFLLSKGTTVHVPMMHQTESFAFGVDKELGCSILQ 262

  Fly   249 LPYTGTDIVFLIILPQEEQGLAIVEEKLMGIDLNEISSQLRRRKVRVQLPKFKFEFDVPLQAALE 313
            :.|.| |.|...:||.:.: :..:|:.|....|.:.|..|::|.::|.:|||.......|:..|.
Mouse   263 MDYRG-DAVAFFVLPGKGK-MRQLEKSLSARRLRKWSRSLQKRWIKVFIPKFSISASYNLETILP 325

  Fly   314 ELGIKKLFSPGANLSSLYQGSEPLRISEVKHKAIIEVNEKGTTASGATFIKVSVESLTIGEEVFE 378
            ::||:..|:..|:.|.:.: :..|::|:..|||:::|:|:||.|:.||..|:.|.|......:..
Mouse   326 KMGIRDAFNSNADFSGITK-THFLQVSKAAHKAVLDVSEEGTEAAAATTTKLIVRSRDTPSSIIA 389

  Fly   379 FIADHPFFFAI--KDAQNTLFLGHV 401
            |  ..||...:  |:.::.||||.|
Mouse   390 F--KEPFLILLLDKNTESVLFLGKV 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 114/378 (30%)
Serpina9NP_001348839.1 alpha-1-antitrypsin_like 49..412 CDD:239011 114/373 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6342
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.