DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and SERPINA7

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_006724746.1 Gene:SERPINA7 / 6906 HGNCID:11583 Length:425 Species:Homo sapiens


Alignment Length:430 Identity:111/430 - (25%)
Similarity:188/430 - (43%) Gaps:55/430 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLQGLNLAMANTLNYSKSPAGE--------------------AQFASQLFGQLAKSQSGRNIV 53
            :||:.||:..:     :..||.|:                    |.||..|:.:.......:||.
Human     8 VLLVLGLHATI-----HCASPEGKVTACHSSQPNATLYKMSSINADFAFNLYRRFTVETPDKNIF 67

  Fly    54 FSPSSIRTGLALAYLGAEGSTADEL--KLGLGLEGAGKTEVAEKLDQLLAKGQWEKASGDEDVPK 116
            |||.||...|.:...||..||..|:  .||..|......|:......|:....:.|..     .:
Human    68 FSPVSISAALVMLSFGACCSTQTEIVETLGFNLTDTPMVEIQHGFQHLICSLNFPKKE-----LE 127

  Fly   117 LKYANRIFVTQRFKLTQTYQDLVSKNFAAAAENVNFTQKADTAKHINSWVEEQTHQQIKDLIAPE 181
            |:..|.:|:.:..|....:.:.|...:.....:.:|:..:...:.|||.||.||..::..||  :
Human   128 LQIGNALFIGKHLKPLAKFLNDVKTLYETEVFSTDFSNISAAKQEINSHVEMQTKGKVVGLI--Q 190

  Fly   182 SLDADTSAILVNAIYFKADWQSSF-PDYATYASDFVNHGGRKVSVDTMSQ-EDYFRFGELTELKA 244
            .|..:|..:|||.|:|||.|.:.| |.....:|.|:......|.|..|.| |.|:...:: ||..
Human   191 DLKPNTIMVLVNYIHFKAQWANPFDPSKTEDSSSFLIDKTTTVQVPMMHQMEQYYHLVDM-ELNC 254

  Fly   245 KVVELPYTGTDIVFLIILPQEEQGLAIVEEKLMGIDLNEISSQLRRRKVRVQLPKFKFEFDVPLQ 309
            .|:::.|: .:.:.|.:||:|.| :..||..:....|.:.:..|::..|.:.:|||.......|.
Human   255 TVLQMDYS-KNALALFVLPKEGQ-MESVEAAMSSKTLKKWNRLLQKGWVDLFVPKFSISATYDLG 317

  Fly   310 AALEELGIKKLFSPGANLSSLYQGSEPLRIS----------EVKHKAIIEVNEKGTTASGATFIK 364
            |.|.::||:..:|..|:.|.|.: ...|::|          :..|||::.:.||||.|:....::
Human   318 ATLLKMGIQHAYSENADFSGLTE-DNGLKLSNRPAGFVLPTQAAHKAVLHIGEKGTEAAAVPEVE 381

  Fly   365 VSVE-SLTIGEEVFEFIADHPFFFAI--KDAQNTLFLGHV 401
            :|.: ..|....:.:.  |..|...|  :..::.||||.|
Human   382 LSDQPENTFLHPIIQI--DRSFMLLILERSTRSILFLGKV 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 104/406 (26%)
SERPINA7XP_006724746.1 alpha-1-antitrypsin_like 46..419 CDD:239011 103/385 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.