DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and SERPINE3

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001094790.1 Gene:SERPINE3 / 647174 HGNCID:24774 Length:424 Species:Homo sapiens


Alignment Length:390 Identity:100/390 - (25%)
Similarity:173/390 - (44%) Gaps:40/390 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EAQFASQLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTADELKLGLGLEGAGKTEVAEKL 96
            :.:||..|:..:|..::..|.|.||:.:...|.:...||||||..:|...||.....| .|.:.|
Human    30 KTEFALHLYQSVAACRNETNFVISPAGVSLPLEILQFGAEGSTGQQLADALGYTVHDK-RVKDFL 93

  Fly    97 DQLLAKGQWEKASGDEDVPKLKYANRIFVTQRFKLTQTYQDLVSKNFAAAAENVNFTQKADTAKH 161
            ..:.|... ..:.|.|    ::.|..:||.....|:..:.:.||....::.|..:.::...||..
Human    94 HAVYATLP-TSSQGTE----MELACSLFVQVGTPLSPCFVEHVSWWANSSLEPADLSEPNSTAIQ 153

  Fly   162 INSWVEEQT-------------HQQIKDLIAPESLDADTSAILVNAIYFKADWQSSFPDYATYAS 213
            .:.....:|             .:|:....|        ..:||:.:.|:..|:..|....|...
Human   154 TSEGASRETAGGGPSEGPGGWPWEQVSAAFA--------QLVLVSTMSFQGTWRKRFSSTDTQIL 210

  Fly   214 DFVNHGGRKVSVDTMSQEDYFRFGELTEL---KAKVVELPYTGTDIVFLIILPQE-EQGLAIVEE 274
            .|....|..:.|..|.|.....:|:..:.   :..|:||||.|:.:...::||:: :..|:.:|.
Human   211 PFTCAYGLVLQVPMMHQTTEVNYGQFQDTAGHQVGVLELPYLGSAVSLFLVLPRDKDTPLSHIEP 275

  Fly   275 KLMGIDLNEISSQLRRRKVRVQLPKFKFEFDVPLQAALEELGIKKLFSP-GANLSSLYQGSEPLR 338
            .|....::..::.|||.::.|.||:|:.:....|::.|...|:..||.| .|||..: .|.:...
Human   276 HLTASTIHLWTTSLRRARMDVFLPRFRIQNQFNLKSILNSWGVTDLFDPLKANLKGI-SGQDGFY 339

  Fly   339 ISEVKHKAIIEVNEKGTTASGATFIKVSVESLTIGEEVFEFIADHPFFFAIKDAQN--TLFLGHV 401
            :||..|||.|||.|:||.|||||.:.:...|     .:..|.||.||.:.:::...  |:|...:
Human   340 VSEAIHKAKIEVLEEGTKASGATALLLLKRS-----RIPIFKADRPFIYFLREPNTGITVFFDRI 399

  Fly   402  401
            Human   400  399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 100/388 (26%)
SERPINE3NP_001094790.1 SERPIN 31..399 CDD:238101 100/387 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..174 3/30 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.