DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Serpina3i

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_017170641.1 Gene:Serpina3i / 628900 MGIID:2182841 Length:457 Species:Mus musculus


Alignment Length:424 Identity:137/424 - (32%)
Similarity:198/424 - (46%) Gaps:69/424 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NLAMANTLNYSKSPAGEAQFASQLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTADELKL 80
            |:...::|..:.|   ...||..|:.:|.......|:||||.||.|.|||..|||:.:|..|:..
Mouse    63 NITSGDSLTVASS---NTDFAFSLYRKLVLKNPDENVVFSPFSIFTALALLSLGAKSNTLKEILE 124

  Fly    81 GLGLEGAGKTEVAEK---------LDQLLAKGQWEKASGDEDVPKLKYANRIFVTQRFKLTQTYQ 136
            ||..   ..||..|.         ||.|...|         |..::...:.:||.:..::...::
Mouse   125 GLKF---NLTETPEPDIHQGFRYLLDLLSQPG---------DQVQISTGSALFVEKHLQILAEFK 177

  Fly   137 DLVSKNFAAAAENVNFTQKADTAKHINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFK--- 198
            :.....:.|.|...:|.|.....|.||.:|..||..:||:||:  .||..|..:|||.||||   
Mouse   178 EKARALYQAEAFTADFLQPCQAKKLINDYVSNQTQGKIKELIS--DLDKSTLMVLVNYIYFKGGR 240

  Fly   199 -----------ADWQSSFPDYATYASDFVNHGGRKVSVDTMSQED----YFRFGELTELKAKVVE 248
                       ..|:..|....|:.|.|.....|.|.|..|..|:    |||..||:   ..|||
Mouse   241 GHCLGVEREELGKWKMPFDPRDTFNSKFYLDEKRSVKVPMMKIEELTTPYFRDDELS---CSVVE 302

  Fly   249 LPYTGTDIVFLIILPQEEQG-LAIVEEKLMGIDLNEISSQLRRRKV-RVQLPKFKFEFDVPLQAA 311
            |.||| :...|.|||  :|| :..||..|....|.:..:.|:..:: .:.||||....|..|:..
Mouse   303 LKYTG-NASALFILP--DQGKMQQVETSLHPETLRKWKNSLKPSRISELHLPKFSISNDYSLEHV 364

  Fly   312 LEELGIKKLFSPGANLSSLYQGSEPLRISEVKHKAIIEVNEKGTTASGATFIKVS-----VESLT 371
            |..|||:::||..|:||:: .|:..||:|:|.|||:::|.|.||.|:.||.:||:     :.|:|
Mouse   365 LPVLGIREVFSMQADLSAI-TGTMDLRVSQVVHKAVLDVTETGTEAAAATGVKVNLRCGKIYSMT 428

  Fly   372 IGEEVFEFIADHPFFFAIKDAQNT---LFLGHVS 402
            |   .|:    .||...|.|. ||   ||:..|:
Mouse   429 I---YFK----RPFLIIISDI-NTHIALFMAKVT 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 133/406 (33%)
Serpina3iXP_017170641.1 serpinA3_A1AC 62..457 CDD:381019 137/424 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.