DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and SERPINB9

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_004146.1 Gene:SERPINB9 / 5272 HGNCID:8955 Length:376 Species:Homo sapiens


Alignment Length:374 Identity:120/374 - (32%)
Similarity:198/374 - (52%) Gaps:16/374 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FASQLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTADELKLGLGLEGAGKTEVAEKLDQL 99
            ||.:|...|.:.....|:..||.||.:.||:..|||:|:||.::...|.|.  .:.::......|
Human    11 FAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLN--TEEDIHRAFQSL 73

  Fly   100 LAKGQWEKASGDEDVPKLKYANRIFVTQRFKLTQTYQDLVSKNFAAAAENVNFTQKA-DTAKHIN 163
            |.:   ...:|.:.:  |:.|||:|..:..:...|:::...:.:.|..:.::|.:.| ::.||||
Human    74 LTE---VNKAGTQYL--LRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHIN 133

  Fly   164 SWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSSFPDYATYASDFVNHGGRKVSVDTM 228
            :||.::|..:|::|:...|:||:|..:||||||||..|...|.:..|....|..:...:..|..|
Human   134 TWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMM 198

  Fly   229 SQEDYFRFGELTELKAKVVELPYTGTDIVFLIILPQEEQGLAIVEEKLMGIDLNEISSQ--LRRR 291
            .||..|:...:.|::|:::||||...::..|::||.:...|:.||:.|....|...:..  ::..
Human   199 YQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKST 263

  Fly   292 KVRVQLPKFKFEFDVPLQAALEELGIKKLFSPG-ANLSSLYQGSEPLRISEVKHKAIIEVNEKGT 355
            :|.|.|||||.:.|..:::.|..|||...|..| |:||:: .....|.:|:..||:.:||||:||
Human   264 EVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAM-SAERDLCLSKFVHKSFVEVNEEGT 327

  Fly   356 TASGATFIKVSVESLTIGEEVFEFIADHPFFFAIKD--AQNTLFLGHVS 402
            .|:.|:...|..|...  |....|.|||||.|.|:.  |.:.||.|..|
Human   328 EAAAASSCFVVAECCM--ESGPRFCADHPFLFFIRHNRANSILFCGRFS 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 119/371 (32%)
SERPINB9NP_004146.1 SERPIN 4..376 CDD:320777 120/374 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.