DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and SERPINB8

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001353127.1 Gene:SERPINB8 / 5271 HGNCID:8952 Length:374 Species:Homo sapiens


Alignment Length:374 Identity:120/374 - (32%)
Similarity:190/374 - (50%) Gaps:18/374 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FASQLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTADELKLGLGLEGAGKTEVAEKLDQL 99
            ||..||..|.:..:.||:.|||.||.:.||:.::||:||||.::...|.|...|  ::......|
Human    11 FAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDG--DIHRGFQSL 73

  Fly   100 LAKGQWEKASGDEDVPKLKYANRIFVTQRFKLTQTYQDLVSKNFAAAAENVNFTQKADTA-KHIN 163
            |::   ...:|.:.:  |:.|||:|..:.......:::...|.:.|..|.::|.:..:.. ||||
Human    74 LSE---VNRTGTQYL--LRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHIN 133

  Fly   164 SWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSSFPDYATYASDFVNHGGRKVSVDTM 228
            .||.|:|..:|.:::...::|..|..:||||||||..|...|....|....|..:..:| :|..|
Human   134 DWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKK-TVQMM 197

  Fly   229 SQEDYFRFGELTELKAKVVELPYTGTDIVFLIILPQEEQGLAIVEEKLMGIDLN--EISSQLRRR 291
            .:|..|:.|...|:..:|:||||...::..:|:||.:...||:||:.|......  ..|.:|.:.
Human   198 FKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVVEKALTYEKFKAWTNSEKLTKS 262

  Fly   292 KVRVQLPKFKFEFDVPLQAALEELGIKKLFSPG-ANLSSLYQGSEPLRISEVKHKAIIEVNEKGT 355
            ||:|.||:.|.|....|:..|..||:...|... |:.|.: ...:.:.:|:|.||..:||||:||
Human   263 KVQVFLPRLKLEESYDLEPFLRRLGMIDAFDEAKADFSGM-STEKNVPLSKVAHKCFVEVNEEGT 326

  Fly   356 TASGATFIKVSVESLTIGEEVFEFIADHPFFFAIKDAQNT--LFLGHVS 402
            .|:.||.:   |.:.........|.|||||.|.|:..:..  ||.|..|
Human   327 EAAAATAV---VRNSRCSRMEPRFCADHPFLFFIRHHKTNCILFCGRFS 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 119/371 (32%)
SERPINB8NP_001353127.1 SERPIN 4..374 CDD:320777 120/374 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.