DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and SERPINA5

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_000615.3 Gene:SERPINA5 / 5104 HGNCID:8723 Length:406 Species:Homo sapiens


Alignment Length:411 Identity:128/411 - (31%)
Similarity:198/411 - (48%) Gaps:27/411 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CSLLLL-QGLNLAMANTLNYSK-----------SPAGEAQFASQLFGQLAKSQSGRNIVFSPSSI 59
            |.:||. ||.:|...:.....|           :|:....|...|:..||.:...::|.|||.||
Human     8 CLVLLSPQGASLHRHHPREMKKRVEDLHVGATVAPSSRRDFTFDLYRALASAAPSQSIFFSPVSI 72

  Fly    60 RTGLALAYLGAEGSTADEL--KLGLGLEGAGKTEVAEKLDQLLAKGQWEKASGDEDVPKLKYANR 122
            ...||:..|||..||..::  .|||.|:.:.:.|:.....|||     ::.:...|..:|...|.
Human    73 SMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQQLL-----QELNQPRDGFQLSLGNA 132

  Fly   123 IFVTQRFKLTQTYQDLVSKNFAAAAENVNFTQKADTAKHINSWVEEQTHQQIKDLIAPESLDADT 187
            :|......|..|:...:...:.|.....||...|...|.||.:|.:||..:|.||:  ::||::.
Human   133 LFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAMKQINDYVAKQTKGKIVDLL--KNLDSNA 195

  Fly   188 SAILVNAIYFKADWQSSFPDYATYASDFVNHGGRKVSVDTMSQEDYFRFGELTELKAKVVELPYT 252
            ..|:||.|:|||.|::||....|...||.......|.|..||:||.:.:.....|..:||.:||.
Human   196 VVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQ 260

  Fly   253 GTDIVFLIILPQEEQGLAIVEEKLMGIDLNEISSQLRRRKVRVQLPKFKFEFDVPLQAALEELGI 317
            | :...|.|||.|.: :..||..|....|.:.....::|::.:.||||..|....|:..|..|||
Human   261 G-NATALFILPSEGK-MQQVENGLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVLPSLGI 323

  Fly   318 KKLFSPGANLSSLYQGSEPLRISEVKHKAIIEVNEKGTTASGATFIKVSVESLTIGEEVFEFIAD 382
            ..:|:..|:||.:...|. :::||:.|||::||:|.||.|:.||....:..|..:..:  ..:.:
Human   324 SNVFTSHADLSGISNHSN-IQVSEMVHKAVVEVDESGTRAAAATGTIFTFRSARLNSQ--RLVFN 385

  Fly   383 HPFFFAIKDAQNTLFLGHVSQ 403
            .||...|.| .|.||||.|::
Human   386 RPFLMFIVD-NNILFLGKVNR 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 119/371 (32%)
SERPINA5NP_000615.3 alpha-1-antitrypsin_like 44..403 CDD:239011 119/371 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.