DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and serpinb5

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001011282.1 Gene:serpinb5 / 496735 XenbaseID:XB-GENE-5802997 Length:379 Species:Xenopus tropicalis


Alignment Length:406 Identity:116/406 - (28%)
Similarity:185/406 - (45%) Gaps:62/406 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LAMANTLNYSKSPAGEAQFASQLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTADELKLG 81
            |.:|||           ..|..:|.:|.:..:..|.|.||..|.:.|:|...|::|:||.||:..
 Frog     4 LRLANT-----------ALAVDIFKKLCEKSATDNFVCSPLCISSSLSLIRKGSQGNTASELEKA 57

  Fly    82 LGLEGAGKTEVAEKLDQLLAKGQWEKASGDEDVPKLKYAN------RIFVTQRFKLTQTYQDLVS 140
            |..|   |.:..:...|||:          .|:.|:..||      |::|....:..:.:.:...
 Frog    58 LHFE---KVKDPDFGFQLLS----------SDISKISSANSLKLLKRVYVDNSIECKKDFINSAK 109

  Fly   141 KNFAAAAENVNFTQKADTAK-HINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSS 204
            |.:....|.::|..:|:.|: .|||.|:|.|....:.::...|.|.:|..|::.|..||..|..:
 Frog   110 KPYPLELETIDFKSQAEEARTQINSSVKELTDGNFETVLNEGSCDENTKIIMLGAASFKGKWVYT 174

  Fly   205 FPDYATYASDFVNHGGRKVS--VDTMSQEDYFRFGELTELKAKVVELPYTGTDIVFLIILPQEEQ 267
            |....|...||  |..:|.:  |..|..|.....|.:.|||..|:|:|:.......||:||::  
 Frog   175 FNKSETKEMDF--HINKKETKPVQMMHLEARLSIGYINELKTMVLEMPFQSKHFSMLILLPKD-- 235

  Fly   268 GLAIVEEKLMGIDLNEIS------------SQLRRRKVRVQLPKFKFEFDVPLQAALEELGIKKL 320
                :|:...|:...|..            |.:...||:|.|||||.|....|:..|:.|||...
 Frog   236 ----IEDDSTGLKKLEQDMTFEKYTHWTNPSMMANSKVKVSLPKFKMENSYDLKDMLKSLGINDA 296

  Fly   321 FSPGANLSSLYQGSEPLRISEVKHKAIIEVNEKGTTASGATFIKVSVESLTIGEEVFEFIADHPF 385
            |:..|:..|....|:.:.||:...||.|||:|.||.::     .||:|...:.:|  ||:|||||
 Frog   297 FNEEASDFSEMTESKGISISQAIQKACIEVDEDGTESA-----DVSMERRLMNKE--EFLADHPF 354

  Fly   386 FFAIK--DAQNTLFLG 399
            .:.::  ..:..:.||
 Frog   355 IYILRHNKTRTIIMLG 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 112/392 (29%)
serpinb5NP_001011282.1 serpinB5_maspin 1..375 CDD:381013 116/406 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.