DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and serpina3

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001011275.1 Gene:serpina3 / 496728 XenbaseID:XB-GENE-5933441 Length:414 Species:Xenopus tropicalis


Alignment Length:388 Identity:109/388 - (28%)
Similarity:189/388 - (48%) Gaps:47/388 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FASQLFGQLA------KSQSGRNIVFSPSSIRTGLALAYLGAEGSTADELKLGLGLEGAGKTEVA 93
            ||..|:..|.      |..:.:||||||.||.|..::..|||:..:..::..||.|   .:|:|.
 Frog    47 FALNLYKHLVTKTQAEKESTQKNIVFSPLSILTAFSMLLLGAKSESHQQILSGLSL---NQTQVP 108

  Fly    94 EK--------LDQLLAKGQWEKASGDEDVPK----LKYANRIFVTQRFKLTQTYQDLVSKNFAAA 146
            |:        |.|:|.:            ||    :|..|.:||....|:..::...:..::.|.
 Frog   109 EEDMHEAFEHLLQVLNR------------PKSDLQVKIGNAVFVEDTLKILDSFVQEIEHHYHAE 161

  Fly   147 AENVNFTQKADTAKHINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSSFPDYATY 211
            ....:|...|:..|.||.:|..:|..:|::|:  :.|...|..:::|.|.|.|:||:.|..:.|:
 Frog   162 IFPSHFKNPAEAEKQINDFVNNKTEGRIQELV--KDLSEATKLVVINFILFNAEWQNPFSSFFTH 224

  Fly   212 ASDFVNHGGRKVSVDTMSQEDYFRFGELTELKAKVVELPYTGTDIVFLIILPQEEQG-LAIVEEK 275
            :..|.......|.|..||:.|.::|.:..::...|::|||. .:...|||:|  |.| :..|||.
 Frog   225 SRQFSVDENTTVEVQMMSKTDLYQFYKDEKIPCSVLQLPYK-NNASMLIIVP--ELGKIHEVEEA 286

  Fly   276 LMGIDLNEISSQLRRRKVRVQLPKFKFEFDVPLQAALEELGIKKLFSPGANLSSLYQGSEPLRIS 340
            |....|...:|...:....:.||||.....:.|:..|.::|:..:|:..|:.|.:.:.|. |::|
 Frog   287 LSVETLKRWTSSAEKSFFELFLPKFSISSSLKLKDILTDMGMGIIFTDAADFSGISENSR-LKLS 350

  Fly   341 EVKHKAIIEVNEKGTTASGATFIKVSVESLTIGEEVFEFIADHPFFFAI--KDAQNTLFLGHV 401
            :|.|||::.|.|.||.|:.|:.::..:.||.:     :|:.|.||...|  ::..:.||:..|
 Frog   351 KVVHKAVLNVAENGTEAAAASAVEGVLTSLMV-----QFVVDKPFITLICSQEPYSILFMSRV 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 108/386 (28%)
serpina3NP_001011275.1 serpinA 43..411 CDD:381073 109/388 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.