DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Spn27A

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster


Alignment Length:366 Identity:102/366 - (27%)
Similarity:174/366 - (47%) Gaps:17/366 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTADELKL-GLGLEGAGKTEVAEKLDQLLAKGQWE 106
            |....:.:|::.||.|::..|||....|...|..:::| ....:...:..|.|...:.|...:.|
  Fly    85 LQNETADKNVIISPFSVKLVLALLAEAAGAGTQTQVELANTQTDIRSQNNVREFYRKTLNSFKKE 149

  Fly   107 KASGDEDVPKLKYANRIFVTQRFKLTQTYQDLVSKNFAAAAENVNFTQKADTAKHINSWVEEQTH 171
            ....:....:.|.....|:..:.|.|.|.:..    :.:..|.::||.....|..||:|....|.
  Fly   150 NQLHETLSVRTKLFTDSFIETQQKFTATLKHF----YDSEVEALDFTNPEAAADAINAWAANITQ 210

  Fly   172 QQIKDLIAPESLDADTSAILVNAIYFKADWQSSFPDYATYASDFVNHGGRKVSVDTMSQEDYFRF 236
            .:::.|:||:::.:.. .:|.|.|||...|:..|.  .|:...|......:...:.|.|.|||.:
  Fly   211 GRLQQLVAPDNVRSSV-MLLTNLIYFNGLWRRQFA--TTFQGSFFRSKDDQSRAEFMEQTDYFYY 272

  Fly   237 GELTELKAKVVELPYTGTDIVFLIILPQEEQGLAIVEEKLMGIDLNEISSQLRRRKVRVQLPKFK 301
            ....:|||:::.|||.|.:.:| ::||....|:..:.:.|...:|......:...||:|.||||.
  Fly   273 TTSEKLKAQILRLPYKGKNSLF-VLLPYALNGIHDLVKNLENDELKSAQWAMEEVKVKVTLPKFH 336

  Fly   302 FEFDVPLQAALEELGIKKLFSPGANLSSLYQGSE---PLRISEVKHKAIIEVNEKGTTASGATFI 363
            |::...|:..|..||::::|...|:|..|.:|::   .:::|.:..||.|.||||||.|..||. 
  Fly   337 FDYQQNLKETLRSLGVREIFEDSASLPGLTRGADVAGKVKVSNILQKAGINVNEKGTEAYAATV- 400

  Fly   364 KVSVESLTIGE-EVFEFIADHPFFFAIKDAQ--NTLFLGHV 401
             |.:|:...|. .:.||..:.||.|.|::..  |.||.|.|
  Fly   401 -VEIENKFGGSTAIEEFNVNRPFVFFIEEESTGNILFAGKV 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 101/364 (28%)
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 101/364 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.