DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Spn100A

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_651818.1 Gene:Spn100A / 43642 FlyBaseID:FBgn0039795 Length:649 Species:Drosophila melanogaster


Alignment Length:353 Identity:82/353 - (23%)
Similarity:142/353 - (40%) Gaps:70/353 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LGAEGSTADE---LKLGL-GLEGAGKTEVAEKLDQLLAKGQWEKASGDEDVPKLKYANRIFVTQR 128
            :.|...||.|   ::|.| .||.|.||...:..|:::...:....|    |.::..|..:|    
  Fly   319 MAAPALTAGEPEKVRLPLQKLENAVKTAAKDGADEIMLALESHLPS----VSRVNGARSLF---- 375

  Fly   129 FKLTQTYQDLVSKNFAAAAENVNFTQKADTAKHINSWVEEQTHQQIKDLIAPESLDADTSAILVN 193
                  .||.::...:|                 ||             |...|..:.:..:|.|
  Fly   376 ------QQDDITSALSA-----------------NS-------------ITGRSAGSKSKMLLFN 404

  Fly   194 AIYFKADWQSSFPDYATYASDF---VNHGGRKVSVDTMSQEDYFRFGELTELKAKVVELPYTGTD 255
            .:|::..|.:.|......:.:|   .|...  |....|.....|:..:|.::||:|:.|||..:.
  Fly   405 GLYYRGSWANPFYQLRDGSDEFFFMTNEDA--VKAPMMHARGKFQVADLPQVKARVLSLPYETSR 467

  Fly   256 IVFLIILPQEEQGLAIVEEKLMGIDLNEISSQLRRRKVRVQLPKFKFEFDVPLQAALEELGIKKL 320
            ....|:||.|.:||:.|..:|...|......|.:.:::.:.:|||:.|.....:|.|:::|:||:
  Fly   468 YALCIVLPDETEGLSDVISQLQTSDFLLAKKQFQMKELHISMPKFQVEETSRSEAMLKQMGLKKV 532

  Fly   321 FSPGANLSSLYQGSEPLRISEVKHKAIIEVNEKGTTASGATFIKV-----SVESLTI-------- 372
            ||......||......:.:.|:.....:.|:|.|::|:..:...:     ||||..:        
  Fly   533 FSRTEAQLSLLSEDPDVHVDEIVQFVNVRVDEGGSSANSLSAATMQARTPSVESTVLPVPEPEPE 597

  Fly   373 --GEEVFEFIADHPFFFAIKDAQNTLFL 398
              |.|.||  .:.||.:.|.|.|....|
  Fly   598 LPGVERFE--VNRPFAYFIVDCQEQFVL 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 82/353 (23%)
Spn100ANP_651818.1 SERPIN 41..>148 CDD:294093
SERPIN <380..628 CDD:294093 64/278 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.