DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and serpine2

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_988931.2 Gene:serpine2 / 394528 XenbaseID:XB-GENE-947567 Length:395 Species:Xenopus tropicalis


Alignment Length:380 Identity:128/380 - (33%)
Similarity:186/380 - (48%) Gaps:35/380 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 QLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTADELKLGLGLEGAGKTEVAEKLDQLLAK 102
            |:|.|:.||:...|.|.||..|.:.|.:..|||:|.|..:|...:..:   ..|||:.|.::   
 Frog    36 QVFNQVVKSRPHENFVMSPHGISSVLGMLQLGADGKTKKQLMTVMRYK---INEVAKSLKKI--- 94

  Fly   103 GQWEKASGDEDVPKLKYANRIFVTQRFKLTQTYQDLVSKN---FAAAAENVNFTQKADTAKHINS 164
            .:...|..::|:  :..||.:|.:..||:..::   |.||   |.:...:|:|.:|...|..||.
 Frog    95 NRAIVAKKNKDI--VTSANGVFASSVFKMESSF---VYKNKDVFHSDVRSVDFQEKNTAASIINQ 154

  Fly   165 WVEEQTHQQIKDLIAPESLDAD-TSAILVNAIYFKADWQSSFPDYATYASDFVNHGGRKVSVDTM 228
            ||:.||:..|:.||:||.||:. |..:||||:|||..|:|.|....|....|....|:...|..:
 Frog   155 WVKNQTNGMIEGLISPELLDSSVTRLVLVNALYFKGLWKSRFQPENTKKRTFHGPDGKDYQVPML 219

  Fly   229 SQEDYFRFGELTE---LKAKVVELPYTGTDIVFLIILPQEEQG--LAIVEEKLMGIDLNEISSQL 288
            :|...||.|..:.   |...|:||||.|..:..|:.||.||..  .||:..    |....:.|.:
 Frog   220 AQLSLFRSGSASTPNGLWYNVIELPYHGGSLSMLVALPTEESTPLSAIIPH----ISTKTLQSWM 280

  Fly   289 RRRKVRVQ--LPKFKFEFDVPLQAALEELGIKKLFSPG-ANLSSLYQGSEPLRISEVKHKAIIEV 350
            .....|||  ||||..|.:..|:..|..|||.::|... ||.:.:.: ||.|.:|.:..||.|||
 Frog   281 TMTPKRVQLILPKFSVEAEADLKEPLRNLGITEMFDVSKANFAKITR-SESLHVSHLLQKAKIEV 344

  Fly   351 NEKGTTASGATFIKVSVESLTIGEEVFEFIADHPFFFAIKDAQN--TLFLGHVSQ 403
            ||.||.|||||...:...|     ....|..|.||.|.|:....  .||.|.:::
 Frog   345 NEDGTKASGATTAVLIARS-----SPRWFTVDRPFLFFIRHNPTGAVLFTGQINK 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 128/376 (34%)
serpine2NP_988931.2 serpinE2_GDN 30..393 CDD:381039 128/377 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.