DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and AT1G62160

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_176407.2 Gene:AT1G62160 / 3767608 AraportID:AT1G62160 Length:220 Species:Arabidopsis thaliana


Alignment Length:168 Identity:48/168 - (28%)
Similarity:72/168 - (42%) Gaps:34/168 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 KVVELPY------TGTDIVFLIILPQEEQGLAIVEEKLMGIDLNEISSQLRRRKVRV---QLPKF 300
            ||:.|||      |..:......||.::..|..:.:::.... ..:.|...|.:|.|   ::|||
plant    71 KVLRLPYRQGRDNTNRNFSMYFYLPDKKGELDDLLKRMTSTP-GFLDSHTPRERVEVDEFRIPKF 134

  Fly   301 KFEFDVPLQAALEELGIKKLFSPGANLSSLYQGSEPLRISEVKHKAIIEVNEKGTTASGATFIKV 365
            |.||.....:...:..|.         .|.||            ||:||::|:||.|:.||.. |
plant   135 KIEFGFEASSVFSDFEID---------VSFYQ------------KALIEIDEEGTEAAAATAF-V 177

  Fly   366 SVESLTIGEEVFEFIADHPFFFAIKDAQ--NTLFLGHV 401
            ..|......|..:|:|||||.|.|::.|  ..||.|.:
plant   178 DNEDGCGFVETLDFVADHPFLFLIREEQTGTVLFAGQI 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 48/166 (29%)
AT1G62160NP_176407.2 SERPIN <43..218 CDD:294093 48/168 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.