DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and serpind1

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_878300.1 Gene:serpind1 / 359841 ZFINID:ZDB-GENE-030711-2 Length:507 Species:Danio rerio


Alignment Length:406 Identity:102/406 - (25%)
Similarity:187/406 - (46%) Gaps:39/406 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLQG-LNLAMANTLNYSKSPAGEAQFASQLFGQLA-KSQSGRNIVFSPSSIRTGLALAYLGAE 71
            |.|..| ..|...|.:|        |:|..:|:.:|. :.....||:.:|..|...:.:..||..
Zfish   122 LRLFHGQTRLQRINVVN--------ARFGFRLYRKLRNRLNQTDNILLAPVGISIAMGMMGLGVG 178

  Fly    72 GSTADELKLGLGL------EGAGKTEVAEKLDQLLAKGQWEKASGDEDVPKLKYANRIFVTQRFK 130
            .:|.::|...:|.      ..........||.:.|....:.:..|    ..|:..|.::|.:..:
Zfish   179 PNTQEQLFQTVGFAEFVNASNHYDNSTVHKLFRKLTHRLFRRNFG----YTLRSVNDLYVKRNVQ 239

  Fly   131 LTQTYQDLVSKNFAAAAENVNFTQKADTAKHINSWVEEQTHQQIKDLIAPESLDADTSAILVNAI 195
            :..:::......:.|..::|:|...|...| .|..:::.|...||:.:  :|:|.:.:.:|:|.:
Zfish   240 IQDSFRADAKTYYFAEPQSVDFADPAFLVK-ANQRIQKITKGLIKEPL--KSVDPNMAVMLLNYL 301

  Fly   196 YFKADWQSSFPDYATYASDFVNHGGRKVSVDTMSQEDYFRFGELTELKAKVVELPYTGTDIVFLI 260
            |||..|:..||...|:...|..:..::|.|..|..:..:......||...:::|||.| :|..||
Zfish   302 YFKGTWEQKFPKELTHHRQFRVNEKKQVRVLMMQNKGSYLAAADHELNCDILQLPYAG-NISMLI 365

  Fly   261 ILPQEEQGLAIVEEKLMGIDLNEISSQLRRRKVRVQLPKFKFEFDVPLQAALEELGIKKLFSPGA 325
            .:||:..|:..:|:::....:|:..|.:..|...|..|:||.|.:..|...|:|:|:..:|:...
Zfish   366 AVPQKLSGMRSLEQEISPTLVNKWLSNMTNRTREVVFPRFKLEQNYDLIEHLKEMGMTDIFTEKG 430

  Fly   326 NLSSLYQGSEPLRISEVKHKAIIEVNEKGTTASGAT---FIKVSVESLTIGEEVFEFIADHPFFF 387
            :.|.:  .||.:.|:..||:..|.|||:||.|:..|   |:.:|.::        .||.|.||.|
Zfish   431 DFSPM--TSEKVIINWFKHQGSITVNEEGTEAAAMTHIGFMPLSTQT--------RFIVDRPFLF 485

  Fly   388 AIKDAQN--TLFLGHV 401
            .|.:.:.  .:|:|.|
Zfish   486 LIYEHRTGCVVFMGRV 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 95/381 (25%)
serpind1NP_878300.1 HCII 61..505 CDD:239002 102/406 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.