DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and CG43366

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster


Alignment Length:408 Identity:84/408 - (20%)
Similarity:156/408 - (38%) Gaps:108/408 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EAQFASQLFGQLA----------KSQSGRNIVFSPSSIRTGLALAYLGAEGSTADELKLGLGLEG 86
            :.|..::|..:||          |..|.|::|.||.::.:.|::.:|||.|||:.|:        
  Fly  1678 DLQSFARLCNELAFSYWRAITSEKISSARSLVISPFALTSMLSMVFLGARGSTSGEM-------- 1734

  Fly    87 AGKTEVAEKLDQLLA----------KGQWEKASGDEDVPKLKYANRIFVTQ-RFKLTQTYQDLVS 140
               .|:. |||.::.          ....|:|| |.|:....:...||..: ..|:...:::...
  Fly  1735 ---NEIL-KLDDMVTFNPHLIFKNITNSVEQAS-DSDIATAAFVREIFSDRANGKILPFFKEKTQ 1794

  Fly   141 KNFAAAAENVNFTQKAD-TAKHINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSS 204
            :.:|...|.|||....| ..:..|..|:..|..::.:.:...|:..:.....::|..|:.|    
  Fly  1795 QLYAGHVEEVNFHVVNDIVRRRTNLLVKRHTMGKVLEYLRTNSVWVNGPLATISANLFQTD---- 1855

  Fly   205 FPDYATYASDFVNHGG-------------------RKVSVDTMSQEDYFRFGELTELKAKVVELP 250
                       .:||.                   |.|.:..:.....|..|....|.|.||...
  Fly  1856 -----------CSHGSTTDRDGEMFFQVHPTVRQRRLVPIPAVLYRSGFLAGYEPSLDATVVSFG 1909

  Fly   251 YTGTDIVFLIILPQEEQGLA------IVEEKLMGIDLNE-------ISSQLRRRKVRVQLPKFKF 302
            .....:..:.::|..:..::      .:|..|:....::       ::|.:.|..:.||||:|..
  Fly  1910 RVQNTVSTVYVMPGHQSSISPMDNLDRLERSLVETAFSDKQAWRRLLTSLMDRPGMEVQLPRFSH 1974

  Fly   303 EFDVPLQAALEELGIKKLF-SPGANLSSLY-QGSEPLRISEVKHKAIIEVNEKGTTASGATFIKV 365
            ...|.....|:::|::.|| |..|:|..|. .|:..:.:|:     :|::|         ||   
  Fly  1975 RSFVNASLGLQKMGLRGLFKSDFADLRGLTGAGNRDIFLSD-----MIQIN---------TF--- 2022

  Fly   366 SVESLTIGEEVFEFIADH 383
                .|.|||.   |::|
  Fly  2023 ----STCGEEK---ISEH 2033

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 84/408 (21%)
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 82/399 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.