DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and SERPINA9

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_783866.3 Gene:SERPINA9 / 327657 HGNCID:15995 Length:417 Species:Homo sapiens


Alignment Length:386 Identity:115/386 - (29%)
Similarity:189/386 - (48%) Gaps:25/386 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SPAGE-----AQFASQLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTADELKLGLGLEGA 87
            :||.:     ..||.:|:.:|......:||.|||.|:.|.||:..|||...|..::..|||....
Human    39 TPASQVYSLNTDFAFRLYRRLVLETPSQNIFFSPVSVSTSLAMLSLGAHSVTKTQILQGLGFNLT 103

  Fly    88 GKTEVAEKLDQLLAKGQWEKASGDEDVPK----LKYANRIFVTQRFKLTQTYQDLVSKNFAAAAE 148
            ...|.|      :.:| ::.......||.    ||..:.:||.:..:|...:...|.:.:.|...
Human   104 HTPESA------IHQG-FQHLVHSLTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVF 161

  Fly   149 NVNFTQKADTAKHINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSSF-PDYATYA 212
            :.:|:..:.....|||.|:::|..::.|:|  :.||..|:.:|||.|:|||.|:..| |:|....
Human   162 STDFSNPSIAQARINSHVKKKTQGKVVDII--QGLDLLTAMVLVNHIFFKAKWEKPFHPEYTRKN 224

  Fly   213 SDFVNHGGRKVSVDTMSQEDYFRFGELTELKAKVVELPYTGTDIVFLIILPQEEQGLAIVEEKLM 277
            ..|:......|.|..|.|::.|.||..|||...|:::.|.| |.|...:||.:.: :..:|:.|.
Human   225 FPFLVGEQVTVHVPMMHQKEQFAFGVDTELNCFVLQMDYKG-DAVAFFVLPSKGK-MRQLEQALS 287

  Fly   278 GIDLNEISSQLRRRKVRVQLPKFKFEFDVPLQAALEELGIKKLFSPGANLSSLYQGSEPLRISEV 342
            ...|.:.|..|::|.:.|.:|:|.......|:..|.::||:.:|...|:.|.:.: .:.|::|:.
Human   288 ARTLRKWSHSLQKRWIEVFIPRFSISASYNLETILPKMGIQNVFDKNADFSGIAK-RDSLQVSKA 351

  Fly   343 KHKAIIEVNEKGTTASGATFIKVSVESLTIGEEVFEFIADHPFFFAI--KDAQNTLFLGHV 401
            .|||:::|:|:||.|:.||..|..|.|.. |...|....:..|...|  |.....||||.|
Human   352 THKAVLDVSEEGTEATAATTTKFIVRSKD-GPSYFTVSFNRTFLMMITNKATDGILFLGKV 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 112/381 (29%)
SERPINA9NP_783866.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6342
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.