DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and serpina1

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_017207927.1 Gene:serpina1 / 322701 ZFINID:ZDB-GENE-030131-1421 Length:433 Species:Danio rerio


Alignment Length:376 Identity:101/376 - (26%)
Similarity:182/376 - (48%) Gaps:23/376 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AQFASQLFGQLAKSQ--SGRNIVFSPSSIRTGLALAYLGAEGSTADELKLGLGLEGAGKTEVAEK 95
            |.||..|:.:||.:.  .|:||.|||..|...|:|..:||:.||..::..|||.......:|.|.
Zfish    71 ADFAFSLYKKLASNPDGQGKNIFFSPVGISMALSLLAVGAKASTLSQIYSGLGYSALTPEQVNEG 135

  Fly    96 LDQLLAKGQWEKASGDEDVPKLKYANRIFVTQRFKLTQTYQDLVSKNFAAAAENVNFTQKADTAK 160
            .:.||     ......:|..:|:....:.:...||:...:.......:.:.|..|:|::....|.
Zfish   136 YEHLL-----HMLGHSQDAMQLEAGAGVAIRDGFKVVDQFLKDAQHYYNSEAFGVDFSKPEIAAA 195

  Fly   161 HINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSSFPDYATYASDFVNHGGRKVSV 225
            .||.::..:||.:|.:::  :.|||||..:|:|.:||:..|:..|....|:.:||.......|.|
Zfish   196 EINKFIARKTHDKITNMV--KDLDADTVMMLINYMYFRGKWEKPFDAKLTHKADFKVDQDTTVQV 258

  Fly   226 DTMSQEDYFRFGELTELKAKVVELPYTGTDIVFLIILPQEEQGLAIVEEKLMGIDLNEISSQLRR 290
            |.|.:...:...:....:..|:.:||.| :...:|:||.:.: :..:||.:....|.....:|.|
Zfish   259 DMMKRTGRYDIYQDPVNQTTVMMVPYKG-NTSMMIVLPDDGK-MKELEESICRHHLKNWHDKLFR 321

  Fly   291 RKVRVQLPKFKFEFDVPLQAALEELGIKKLFSPGANLSSLYQGSEPLRISEVKHKAIIEVNEKGT 355
            ..|.:.:|||.......|...|:::|:...|:..|:.|.:.: ...:::|:|.|:|::.|:||||
Zfish   322 SSVDLFMPKFSISATSKLDGILKDMGMTDAFNDKADFSGMTE-EVKVKVSQVLHQAVMSVDEKGT 385

  Fly   356 TASGATFIKVSVESL--TIGEEVFEFIADHPFFFAIKD--AQNTLFLGHVS 402
            .|:..|.|::...||  |:       |.:.||...|.:  ..:.||:|.::
Zfish   386 EAAAITTIEIMPMSLPDTV-------ILNRPFLVLIVEDSTMSILFMGKIT 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 101/373 (27%)
serpina1XP_017207927.1 alpha-1-antitrypsin_like 69..428 CDD:239011 101/373 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.