DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Serpina1f

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001101524.1 Gene:Serpina1f / 314406 RGDID:1307899 Length:412 Species:Rattus norvegicus


Alignment Length:372 Identity:85/372 - (22%)
Similarity:167/372 - (44%) Gaps:28/372 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTADELK--LGLGLEGAGKTEVAEKLDQLLA 101
            ||.::|:.....||:|||..:...:::..|||:|:.:..:.  |.|...|..:.|:.:....|| 
  Rat    55 LFKEMAQLSVNGNILFSPIRVIAAISMLSLGAKGNESKRILEILRLNKTGLPEAEIHKCFRYLL- 118

  Fly   102 KGQWEKASGDEDVPKLKYANRIFVTQRFKLTQTYQDLVSKNFAAAAENVNFTQKADTAKHINSWV 166
                ......|.:..||..:.:|:.|.......:.:.|...:.:...::|||........||:::
  Rat   119 ----RAIHQPEQLSPLKSGSGVFIHQDLTPVDKFVEGVKNLYHSDIVSINFTDCRRAKTQINNYM 179

  Fly   167 EEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSSFPDYATYASDFVNHGGRKVSVDTMSQE 231
            ..:::::||:::  ::|:.||...:||.|.:.|...|.|...:....|:....|..:.|..:...
  Rat   180 MTKSNKEIKNIV--KNLENDTYMAVVNYIIWNAKINSDFGCRSVKQKDYHLEQGMTIKVPMIHIV 242

  Fly   232 DYFRFGELTELKAKVVELPYTGTDIVFLIILPQEEQGLAIVEEKLMGIDLNEISSQLRRRKVRVQ 296
            |......:.:|.:.|:......::.....|:|...| :..||::|.......:..|...|.|.::
  Rat   243 DLNHLFRVEDLSSTVLVFTLLASNFTTYFIIPDIGQ-MQKVEQRLTYPHFRRMRRQSNLRMVNLE 306

  Fly   297 LPKFKFEFDVPLQAALEELGIKKLFSPGANLSSLYQGSEPLR-----ISEVKHKAIIEVNEKGTT 356
            .|:........:::.:..|||..:|:..||.|::.  ::.|:     :|:||    :.:::||:.
  Rat   307 TPELSLSETHDVESMMNLLGITYVFNNDANSSAVM--NDTLQKSFKMVSKVK----LTIDDKGSK 365

  Fly   357 ASGATFIKVSVESLTIGEEVFEFIADHPFFFAIKDAQN--TLFLGHV 401
            ...:|..| :..|:.:|...|    :.||...|||..|  .||||.|
  Rat   366 PGRSTCFK-NDGSVDVGYVQF----NRPFLIFIKDPTNDVPLFLGRV 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 84/370 (23%)
Serpina1fNP_001101524.1 serpin 47..410 CDD:422956 85/372 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.