DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and RGD1564786

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_006253935.2 Gene:RGD1564786 / 306889 RGDID:1564786 Length:420 Species:Rattus norvegicus


Alignment Length:385 Identity:105/385 - (27%)
Similarity:187/385 - (48%) Gaps:36/385 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FASQLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTADELKLGLGLE---GAGKTEVAEKL 96
            ||.:||..|.:..| :|:.||..||.:.|::..:||.|:||.::...:.|:   ..|..:|.:..
  Rat    53 FAIKLFKVLGEDIS-KNVFFSLPSISSALSMILMGANGTTASQICQAMSLDKCNSIGGGDVHQHF 116

  Fly    97 DQLLAKGQWEKASGDEDVPKLKYANRIFVTQRFKLTQTYQDLVSKNFAAAAENVNFTQKADTAK- 160
            ..||.     |.:..:....|:.||.:|:...|::..:::|...|.:.|..|.::|....:.:: 
  Rat   117 LSLLT-----KVNKTDTRCMLRKANSVFIEDSFEILASFKDACHKLYEAEIEELDFKGAPEQSRQ 176

  Fly   161 HINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSSFPDYATYASDFVNHGGRKVSV 225
            |||:||.::|...|::|:.|.:::::|...|||.||||...:..|....|....|......|.:|
  Rat   177 HINTWVAKKTEDIIRELLPPCTVNSNTCLFLVNVIYFKGSLEKPFNKADTREMPFKVSMNEKKTV 241

  Fly   226 DTMSQEDYFRFGELTELKAKVVELPYTGTDIVFLIILPQEEQGLAIVEEKLMGIDLNEIS----- 285
            ..|||:..|:...:.::..:|:.||:..:.:.....:|...    :.:.||.    ||::     
  Rat   242 QMMSQKSTFKMTYVKDISTQVLTLPFENSILSMYFFVPDSH----VAQRKLE----NELTYDKFL 298

  Fly   286 -----SQLRRRKVRVQLPKFKFEFDVPLQAALEELGIKKLFSPG-ANLSSLYQGSEPLRISEVKH 344
                 ..:..:::.|.||:.|.|....:...|.:||:...|... |:.|.: .....|.:|:|.|
  Rat   299 EWTDEDTMEEKEMEVFLPRIKLEESYDMNGVLRKLGMTDAFEEDKADFSGI-SSKHGLFLSKVVH 362

  Fly   345 KAIIEVNEKGTTASGATFIKVSVESLTIGEEVFEFIADHPFFFAIKD--AQNTLFLGHVS 402
            |:.:|::|:||.|:..|.:......||    ....||||||.|:|:|  ::..||||..|
  Rat   363 KSFVEMSEEGTEAAAPTDVVTMKSPLT----PRCLIADHPFLFSIQDTRSKEILFLGRFS 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 104/382 (27%)
RGD1564786XP_006253935.2 SERPIN 46..420 CDD:294093 105/385 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.