DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Serpina6

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001009663.1 Gene:Serpina6 / 299270 RGDID:1595901 Length:396 Species:Rattus norvegicus


Alignment Length:396 Identity:105/396 - (26%)
Similarity:175/396 - (44%) Gaps:32/396 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TCSL-LLLQGLNLAMANTLNYSKSPAGEA----QFASQLFGQLAKSQSGRNIVFSPSSIRTGLAL 65
            ||.| |...||..|.|:|...|.|..|.|    .||..|:.:|......:|.:.||.||...||:
  Rat     7 TCLLWLCTSGLWTAQASTNESSNSHRGLAPTNVDFAFNLYQRLVALNPDKNTLISPVSISMALAM 71

  Fly    66 AYLGAEGSTADELKLGLGLEGAGKTEVAEKLDQL--LAKGQWEKASGDEDVPKLKYANRIFVTQR 128
            ..||: ..|.....||..|....:.|:.:....|  |.|   :..:|.|    :...|.:|:.|:
  Rat    72 VSLGS-AQTQSLQSLGFNLTETSEAEIHQSFQYLNYLLK---QSDTGLE----MNMGNAMFLLQK 128

  Fly   129 FKLTQTYQDLVSKNFAAAAENVNFTQKADTAKHINSWVEEQTHQQIKDLIAPESLDADTSAILVN 193
            .||..::...|.:.:.:.|..::|......::.||..|:::|..:|:.:.:  .||:..|.||||
  Rat   129 LKLKDSFLADVKQYYESEALAIDFEDWTKASQQINQHVKDKTQGKIEHVFS--DLDSPASFILVN 191

  Fly   194 AIYFKADWQSSFPDYATYASDFVNHGGRKVSVDTMSQE---DYFRFGELTELKAKVVELPYTGTD 255
            .|:.:..|:..|....|...||..:....|.|..|.|.   .|||.   :....:::::.|.|..
  Rat   192 YIFLRGIWELPFSPENTREEDFYVNETSTVKVPMMVQSGSIGYFRD---SVFPCQLIQMDYVGNG 253

  Fly   256 IVFLIILPQEEQGLAIVEEKLMGIDLNEISSQLRRRKVRVQLPKFKFEFDVPLQAALEELGIKKL 320
            ..| .|||.:.| :..|...|....::.....:..|:|.:.:|||.......|:..||:|.||.|
  Rat   254 TAF-FILPDQGQ-MDTVIAALSRDTIDRWGKLMTPRQVNLYIPKFSISDTYDLKDMLEDLNIKDL 316

  Fly   321 FSPGANLSSLYQGSEPLRISEVKHKAIIEVNEKGTTASGATFIKVSVESLTIGEEVFEFIADHPF 385
            .:..::.|...: ..||.::.| |||:::::| |.....:|    :...|.:..|..:...:.||
  Rat   317 LTNQSDFSGNTK-DVPLTLTMV-HKAMLQLDE-GNVLPNST----NGAPLHLRSEPLDIKFNKPF 374

  Fly   386 FFAIKD 391
            ...:.|
  Rat   375 ILLLFD 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 94/370 (25%)
Serpina6NP_001009663.1 alpha-1-antitrypsin_like 37..392 CDD:239011 92/366 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.