DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Serpinb6e

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_006253937.2 Gene:Serpinb6e / 291087 RGDID:1561697 Length:379 Species:Rattus norvegicus


Alignment Length:382 Identity:117/382 - (30%)
Similarity:199/382 - (52%) Gaps:26/382 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AQFASQLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTADELKLGLGL---EGAGKTEVAE 94
            |.||.::...|.: .|.:|:.|||.|:.:.|::..|||.|:||.::...|.|   .|.|..:..:
  Rat     9 ATFALKVLRVLGE-DSSKNVFFSPLSMFSSLSMILLGANGTTASQISKVLSLYNCNGNGGGDFHQ 72

  Fly    95 KLDQLLAKGQWEKASGDEDVPKLKYANRIFVTQRFKLTQTYQDLVSKNFAAAAENVNFTQKADTA 159
            ....||.     :.:..:....||.:|.:||...|::..:::|...|.:.|..||::|....:.:
  Rat    73 CFQSLLT-----EVNKSDRRHMLKTSNSVFVEDSFEILASFKDSCRKFYEAEIENMDFKGAPEQS 132

  Fly   160 K-HINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSSFPDYATYASDFVNHGGRKV 223
            : |||:||.::|...|::|::|.:::::|..:|:|:.|||.:|:..|....|....|......|.
  Rat   133 RQHINTWVAKKTEDVIRELLSPGTVNSNTQLVLMNSFYFKGNWEKPFNKEDTREMPFKVSKNEKK 197

  Fly   224 SVDTMSQEDYFRFGELTELKAKVVELPYTGTDIVFLIILPQEEQGLAIVEEKLMGIDLNEIS--S 286
            .|..|..:..||...:.::...:..|||.|..:...|:||.|...|..||.::....|.|.:  .
  Rat   198 IVQMMFNKSNFRTYHVEDISTTLALLPYLGNQLSITIMLPDEYVELRTVENQITYEKLIEWTRLE 262

  Fly   287 QLRRRKVRVQLPKFKFEFDVPLQAALEELGIKKLFSPG-ANLSSLYQGSEP-LRISEVKHKAIIE 349
            .::..:|.:.||:||.|....::..|.:||:...|..| |:.|.:  .|:| |.:|:|.||:::|
  Rat   263 NMQEEEVEILLPRFKLEESYDMKNVLCKLGMTNAFEDGRADFSGI--SSKPGLFLSKVVHKSVVE 325

  Fly   350 VNEKGTTASGATFIKVSVESLTIGEEVFE--FIADHPFFFAIKDAQN--TLFLGHVS 402
            |||:||.|:..|      |.:|:|..:..  .:|||||.|.|:|.:|  .||||..|
  Rat   326 VNEEGTEAAAPT------EIVTMGSPLSPQCLVADHPFLFLIQDDRNKAILFLGRFS 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 116/379 (31%)
Serpinb6eXP_006253937.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.