DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Serpinf2

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001011892.1 Gene:Serpinf2 / 287527 RGDID:1306692 Length:491 Species:Rattus norvegicus


Alignment Length:382 Identity:99/382 - (25%)
Similarity:174/382 - (45%) Gaps:52/382 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FASQLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTADELKLGLGLE-GAGKTEVAEKLDQ 98
            |.:.||..:|::.:..|:|.||.|:...|:...|||...|.:.|:..|.:. |:....:.....|
  Rat    89 FTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGARNQTLENLQRVLHMNMGSCIPHLLSHFCQ 153

  Fly    99 LLAKGQWEKASGDEDVPKLKYANRIFVTQRFKLTQTYQDLVSKNFAAAAENVNFTQKADTAKHIN 163
            .|..|            .::.|.||::.:.|.:...:.:...|.|.|....:...|:.| ..:||
  Rat   154 NLNPG------------TIRLAARIYLQKGFPIKDDFLEQSEKLFGAKPVKLTGRQEED-LMNIN 205

  Fly   164 SWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSSFPDYATYASDFVNHGGRKVSVDTM 228
            .||:|.|..:|:|.::  .|..:|..:|:|||:|...|::.|....|....|.......|.|..|
  Rat   206 KWVKEATEGKIEDFLS--ELPDNTVLLLLNAIHFHGFWRTKFDPSLTQKDSFHLDEQFTVPVAMM 268

  Fly   229 SQEDY-FRFGELTELKAKVVELPYTGTDIVFLIILPQEEQGLAIVEEKLMGIDLNEISSQL---- 288
            ..:.| .|:..|.:.:.:|...|:. .::.|::|:|           ...|.:::|:.:.|    
  Rat   269 HAQSYPLRWFLLEQPEIQVAHFPFQ-NNMSFVVIMP-----------TYFGWNVSEVLANLTWDT 321

  Fly   289 ------RRRKVRVQLPKFKFEFDVPLQAALEELGIKKLF-SPGANLSSLYQGSEPLRISEVKHKA 346
                  |.:..:|:|||...|..:.|.|.|.:||::.|| ||  :|..:  ..:.|.:|.|:|::
  Rat   322 LYQPSMREKPTKVRLPKLHLEQHLDLVATLSKLGLQDLFQSP--DLRGI--SDQSLVVSSVQHQS 382

  Fly   347 IIEVNEKGTTASGATFIKVSVESLTIGEEVFEFIADHPFFFAIKDAQ--NTLFLGHV 401
            .:|::|.|..|:.||...::..||:      .|..:.||.|.|.:..  ..||:|.|
  Rat   383 TMELSEAGVEAAAATSTAMTRMSLS------SFFLNRPFIFFIMEETIGIPLFVGSV 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 98/380 (26%)
Serpinf2NP_001011892.1 alpha2AP 82..433 CDD:239008 98/380 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.