DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and Serpina3b

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_766612.1 Gene:Serpina3b / 271047 MGIID:2182835 Length:420 Species:Mus musculus


Alignment Length:398 Identity:121/398 - (30%)
Similarity:190/398 - (47%) Gaps:37/398 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LQGLNLAMANTLNYSKSPAGEAQFASQLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTAD 76
            |..|.||..||           .||...:.:||.....:||.|||..|.|.|....|||:|:|.:
Mouse    42 LDSLTLASINT-----------DFAFSFYKELALKNPHKNIAFSPFGIATALNSLTLGAKGNTLE 95

  Fly    77 EL--KLGLGLEGAGKTEVAEKLDQLLAKGQWEKASGDEDVPKLKYANRIFVTQRFKLTQTYQDLV 139
            |:  .|...|....:.::.:....||     ::.|...|..:::..|.:||.:..::...:::..
Mouse    96 EILEVLKFNLTETSEADIHQGFKHLL-----QRLSHPGDQVQIRTGNALFVEKHLQILAEFKEKA 155

  Fly   140 SKNFAAAAENVNFTQKADTAKHINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSS 204
            ...:.......||.|..:..|.|||::..||..:||:|::  .:|.:||.::||.::|||:|...
Mouse   156 RALYHTEVFTANFQQPHEAMKLINSYMSNQTQGKIKELVS--DMDGNTSMVIVNDLFFKAEWMVP 218

  Fly   205 FPDYATYASDFVNHGGRKVSVDTMSQED----YFRFGELTELKAKVVELPYTGTDIVFLIILPQE 265
            |....|:...|:....|.|.|..|..::    |||.   .|||..||||.|.|.... :.|||  
Mouse   219 FNSDDTFMGKFIVDRSRHVKVPMMKTKNLRTPYFRD---EELKCTVVELNYKGNGKA-MFILP-- 277

  Fly   266 EQG-LAIVEEKLMGIDLNEISSQLRRRKVR-VQLPKFKFEFDVPLQAALEELGIKKLFSPGANLS 328
            :|| :..||..|....|.:....||.||:: :.||||.......|:..|.||||::|||..|:||
Mouse   278 DQGKMQQVEASLQPGTLKKWRKSLRPRKIKELHLPKFSLSQHYNLEDILPELGIRELFSTQADLS 342

  Fly   329 SLYQGSEPLRISEVKHKAIIEVNEKGTTASGATFIKVSVESLTIGEEVFEFIADHPFFFAIKDAQ 393
            .: .|.:.:.:||:.|...:::.||||.....|.:..:..|..: :.||....|. |.:.:.| |
Mouse   343 GI-TGVKNITVSEMIHSTELDMTEKGTEGDAITIVGYNFMSAKL-KPVFVKFEDQ-FLYIVLD-Q 403

  Fly   394 NTLFLGHV 401
            ..|:: ||
Mouse   404 GDLWI-HV 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 113/377 (30%)
Serpina3bNP_766612.1 SERPIN 51..414 CDD:294093 117/389 (30%)
RCL 367..392 6/25 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.