DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42De and SERPINA11

DIOPT Version :9

Sequence 1:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001073920.1 Gene:SERPINA11 / 256394 HGNCID:19193 Length:422 Species:Homo sapiens


Alignment Length:384 Identity:121/384 - (31%)
Similarity:183/384 - (47%) Gaps:41/384 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FASQLFGQLAKSQSGRNIVFSPSSIRTGLALAYLGAEGSTADELKLGLGLEGAG--KTEVAE--- 94
            ||.:|:.:||....| ||.|||.||.|.|||..|||:.:|:     .|.|||.|  .||..|   
Human    57 FALRLYKELAADAPG-NIFFSPVSISTTLALLSLGAQANTS-----ALILEGLGFNLTETPEADI 115

  Fly    95 -----KLDQLLAKGQWEKASGDEDVPK--LKYANRIFVTQRFKLTQTYQDLVSKNFAAAAENVNF 152
                 .|...||...          ||  ||..|.:|:.:|.|..|.|.|.:.:.:.|.|.:.||
Human   116 HQGFRSLLHTLALPS----------PKLELKVGNSLFLDKRLKPRQHYLDSIKELYGAFAFSANF 170

  Fly   153 TQKADTAKHINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKADWQSSFPDYATYASD--F 215
            |....|.:.||.::..||:.|:.|.: || ...||..:|.|.|:|||.|:..|..|.|...:  |
Human   171 TDSVTTGRQINDYLRRQTYGQVVDCL-PE-FSQDTFMVLANYIFFKAKWKHPFSRYQTQKQESFF 233

  Fly   216 VNHGGRKVSVDTMSQEDYFRFGELTELKAKVVELPYTGTDIVFLIILPQEEQGLAIVEEKLMGID 280
            |:. ...:.|..|.|::..||....:|...|:::.|.|..:. |::||...: :..||..|....
Human   234 VDE-RTSLQVPMMHQKEMHRFLYDQDLACTVLQIEYRGNALA-LLVLPDPGK-MKQVEAALQPQT 295

  Fly   281 LNEISSQLRRRKVRVQLPKFKFEFDVPLQAALEELGIKKLFSPGANLSSLYQGSEPLRISEVKHK 345
            |.:....|....:.:.||:|.......|:..|.::|:..:.:..|:.|.: .|.....||:|.||
Human   296 LRKWGQLLLPSLLDLHLPRFSISGTYNLEDILPQIGLTNILNLEADFSGV-TGQLNKTISKVSHK 359

  Fly   346 AIIEVNEKGTTASGATFIKVSVESL-TIGEEVFEFIADHPFFFAIKD--AQNTLFLGHV 401
            |:::::||||.|..|:.:.....|| |:.:....|  :.||...:.:  .|:.||||.|
Human   360 AMVDMSEKGTEAGAASGLLSQPPSLNTMSDPHAHF--NRPFLLLLWEVTTQSLLFLGKV 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 120/382 (31%)
SERPINA11NP_001073920.1 alpha-1-antitrypsin_like 53..416 CDD:239011 120/382 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.